Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BPJ5

Protein Details
Accession A0A0P1BPJ5   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
200-220DEDSKPNKKKRKAGSGEDKVVBasic
NLS Segment(s)
PositionSequence
205-212PNKKKRKA
Subcellular Location(s) cyto_nucl 11.5, cyto 11, nucl 10, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR046938  DNA_clamp_sf  
IPR000730  Pr_cel_nuc_antig  
IPR022649  Pr_cel_nuc_antig_C  
IPR022659  Pr_cel_nuc_antig_CS  
IPR022648  Pr_cel_nuc_antig_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0030337  F:DNA polymerase processivity factor activity  
GO:0006260  P:DNA replication  
GO:0006275  P:regulation of DNA replication  
Pfam View protein in Pfam  
PF02747  PCNA_C  
PF00705  PCNA_N  
PROSITE View protein in PROSITE  
PS00293  PCNA_2  
CDD cd00577  PCNA  
Amino Acid Sequences MLEARMQSASTLKKVIDAVRDLITDANFDCNEEGIRMQAMDNSHVALSSVELRSDGFAPYRCDRPMSIGVSLVSLTKIIKTADNNDTVTIKKDDDGDSLGIMFESSKSDRVAEYDMKLMDIDSEHLGIPDTQYDAVVSMASGEYARICRDLSVVGESVRIDVSKEGVGFSADGELGVAKLTLKQGAGSATGAGDDDDDDDEDSKPNKKKRKAGSGEDKVVPVEIRLNQSVSLTFSLKYLTMFAKAAPLCDRVSLHMSNEVPLLCEFGFDDGHVRFYLAPKLSEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.31
4 0.3
5 0.3
6 0.3
7 0.3
8 0.28
9 0.27
10 0.23
11 0.18
12 0.16
13 0.18
14 0.15
15 0.16
16 0.15
17 0.14
18 0.14
19 0.14
20 0.14
21 0.1
22 0.1
23 0.1
24 0.1
25 0.12
26 0.12
27 0.13
28 0.14
29 0.14
30 0.13
31 0.12
32 0.12
33 0.1
34 0.1
35 0.12
36 0.12
37 0.11
38 0.12
39 0.12
40 0.13
41 0.14
42 0.14
43 0.12
44 0.15
45 0.21
46 0.24
47 0.28
48 0.27
49 0.28
50 0.27
51 0.31
52 0.34
53 0.31
54 0.29
55 0.26
56 0.25
57 0.24
58 0.23
59 0.17
60 0.11
61 0.09
62 0.08
63 0.07
64 0.08
65 0.09
66 0.11
67 0.13
68 0.2
69 0.23
70 0.27
71 0.27
72 0.26
73 0.27
74 0.24
75 0.26
76 0.21
77 0.17
78 0.15
79 0.17
80 0.17
81 0.16
82 0.18
83 0.15
84 0.13
85 0.13
86 0.12
87 0.09
88 0.07
89 0.06
90 0.04
91 0.06
92 0.07
93 0.09
94 0.09
95 0.1
96 0.1
97 0.12
98 0.16
99 0.15
100 0.16
101 0.17
102 0.16
103 0.16
104 0.16
105 0.14
106 0.1
107 0.08
108 0.08
109 0.06
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.07
116 0.06
117 0.06
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.04
125 0.04
126 0.03
127 0.04
128 0.03
129 0.03
130 0.04
131 0.04
132 0.05
133 0.05
134 0.06
135 0.06
136 0.06
137 0.07
138 0.07
139 0.08
140 0.09
141 0.08
142 0.09
143 0.09
144 0.09
145 0.08
146 0.07
147 0.06
148 0.05
149 0.07
150 0.07
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.06
157 0.06
158 0.05
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.03
166 0.04
167 0.05
168 0.06
169 0.06
170 0.07
171 0.07
172 0.08
173 0.09
174 0.08
175 0.08
176 0.07
177 0.07
178 0.07
179 0.06
180 0.05
181 0.04
182 0.05
183 0.05
184 0.05
185 0.06
186 0.07
187 0.07
188 0.1
189 0.11
190 0.18
191 0.24
192 0.32
193 0.41
194 0.48
195 0.57
196 0.64
197 0.74
198 0.75
199 0.79
200 0.83
201 0.82
202 0.8
203 0.73
204 0.64
205 0.52
206 0.45
207 0.34
208 0.24
209 0.19
210 0.16
211 0.19
212 0.19
213 0.2
214 0.19
215 0.2
216 0.2
217 0.18
218 0.18
219 0.15
220 0.14
221 0.13
222 0.14
223 0.14
224 0.13
225 0.13
226 0.12
227 0.13
228 0.14
229 0.13
230 0.2
231 0.19
232 0.21
233 0.22
234 0.23
235 0.21
236 0.24
237 0.24
238 0.21
239 0.26
240 0.25
241 0.24
242 0.28
243 0.28
244 0.26
245 0.27
246 0.24
247 0.2
248 0.18
249 0.2
250 0.13
251 0.13
252 0.12
253 0.12
254 0.12
255 0.11
256 0.15
257 0.12
258 0.15
259 0.14
260 0.15
261 0.15
262 0.17
263 0.24
264 0.23
265 0.24
266 0.24