Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P1BH45

Protein Details
Accession A0A0P1BH45    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-41QSRKAHRNGIKKPKTNKYPNHydrophilic
NLS Segment(s)
PositionSequence
24-68RKAHRNGIKKPKTNKYPNLRGVNPKFLRNQRYAKHGTEKAVREAR
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MHARAEEFVTMAKSKNASQHNQSRKAHRNGIKKPKTNKYPNLRGVNPKFLRNQRYAKHGTEKAVREARQGKREVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.25
3 0.3
4 0.32
5 0.39
6 0.48
7 0.55
8 0.63
9 0.65
10 0.67
11 0.7
12 0.72
13 0.73
14 0.7
15 0.71
16 0.72
17 0.79
18 0.78
19 0.77
20 0.79
21 0.79
22 0.81
23 0.79
24 0.78
25 0.77
26 0.77
27 0.78
28 0.76
29 0.7
30 0.7
31 0.65
32 0.67
33 0.59
34 0.54
35 0.52
36 0.52
37 0.55
38 0.52
39 0.56
40 0.49
41 0.55
42 0.57
43 0.55
44 0.57
45 0.55
46 0.54
47 0.54
48 0.54
49 0.55
50 0.57
51 0.53
52 0.52
53 0.57
54 0.6
55 0.6