Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P1BGP6

Protein Details
Accession A0A0P1BGP6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-37GFCAALRQPNKRRTRRESKDHPVTRCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MQSIQISSRYSGFCAALRQPNKRRTRRESKDHPVTRCSVRTSNGSQKLASSALACPTRIKQPHELHAREIKPQVDTFARIMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.31
4 0.36
5 0.44
6 0.51
7 0.59
8 0.68
9 0.73
10 0.77
11 0.78
12 0.83
13 0.83
14 0.85
15 0.85
16 0.85
17 0.87
18 0.84
19 0.77
20 0.69
21 0.64
22 0.57
23 0.5
24 0.44
25 0.35
26 0.3
27 0.31
28 0.33
29 0.39
30 0.41
31 0.39
32 0.35
33 0.33
34 0.32
35 0.29
36 0.24
37 0.16
38 0.1
39 0.14
40 0.15
41 0.16
42 0.16
43 0.17
44 0.25
45 0.29
46 0.33
47 0.37
48 0.42
49 0.51
50 0.59
51 0.59
52 0.56
53 0.61
54 0.58
55 0.53
56 0.52
57 0.45
58 0.39
59 0.37
60 0.36
61 0.31
62 0.32