Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BMM3

Protein Details
Accession A0A0P1BMM3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
17-36APPCHPRRLHLQRPHPPTTRBasic
NLS Segment(s)
Subcellular Location(s) mito 9cyto 9cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MDPQSECVATLLARADAPPCHPRRLHLQRPHPPTTRLCAVDLRCMFNSVHEPSEWRAQSTGRVRCAPPIVISPKPGLRNGTRASPPVDAVRAVSPAGGARCRRRHCSIHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.12
4 0.17
5 0.25
6 0.27
7 0.33
8 0.33
9 0.35
10 0.44
11 0.54
12 0.59
13 0.6
14 0.67
15 0.7
16 0.78
17 0.82
18 0.75
19 0.69
20 0.62
21 0.58
22 0.53
23 0.45
24 0.39
25 0.37
26 0.34
27 0.38
28 0.37
29 0.34
30 0.28
31 0.29
32 0.27
33 0.22
34 0.25
35 0.19
36 0.18
37 0.15
38 0.16
39 0.16
40 0.23
41 0.22
42 0.18
43 0.17
44 0.16
45 0.23
46 0.29
47 0.32
48 0.29
49 0.31
50 0.31
51 0.33
52 0.35
53 0.29
54 0.23
55 0.24
56 0.26
57 0.24
58 0.26
59 0.26
60 0.28
61 0.3
62 0.3
63 0.29
64 0.26
65 0.32
66 0.33
67 0.37
68 0.35
69 0.35
70 0.36
71 0.33
72 0.32
73 0.28
74 0.27
75 0.2
76 0.2
77 0.19
78 0.17
79 0.15
80 0.13
81 0.11
82 0.13
83 0.15
84 0.19
85 0.24
86 0.32
87 0.42
88 0.49
89 0.56
90 0.6