Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BLK5

Protein Details
Accession A0A0P1BLK5   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
98-134LATKVEKPSRKLRKERKNRQKKLRGTQKKKGAEAKKKBasic
NLS Segment(s)
PositionSequence
97-134GLATKVEKPSRKLRKERKNRQKKLRGTQKKKGAEAKKK
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MVDATSPVTLRTRKFITNRLLQRRQMVLDVIHPARANVSKAELSEKLATMYKANKEQCVIFGLRTHFGGGRSTGFALIYDSRESMNFEPRHRLVKAGLATKVEKPSRKLRKERKNRQKKLRGTQKKKGAEAKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.49
3 0.51
4 0.57
5 0.65
6 0.69
7 0.72
8 0.69
9 0.69
10 0.65
11 0.58
12 0.5
13 0.42
14 0.32
15 0.28
16 0.3
17 0.25
18 0.23
19 0.21
20 0.19
21 0.2
22 0.21
23 0.2
24 0.14
25 0.17
26 0.15
27 0.16
28 0.2
29 0.18
30 0.19
31 0.19
32 0.18
33 0.17
34 0.17
35 0.17
36 0.16
37 0.19
38 0.19
39 0.25
40 0.26
41 0.25
42 0.25
43 0.25
44 0.24
45 0.23
46 0.2
47 0.13
48 0.15
49 0.16
50 0.15
51 0.15
52 0.15
53 0.12
54 0.12
55 0.13
56 0.11
57 0.1
58 0.1
59 0.1
60 0.09
61 0.08
62 0.07
63 0.08
64 0.08
65 0.09
66 0.09
67 0.09
68 0.09
69 0.1
70 0.13
71 0.12
72 0.2
73 0.22
74 0.23
75 0.29
76 0.31
77 0.36
78 0.33
79 0.33
80 0.25
81 0.29
82 0.32
83 0.3
84 0.3
85 0.28
86 0.3
87 0.32
88 0.39
89 0.38
90 0.37
91 0.38
92 0.47
93 0.55
94 0.63
95 0.7
96 0.73
97 0.79
98 0.86
99 0.93
100 0.93
101 0.94
102 0.95
103 0.95
104 0.95
105 0.94
106 0.94
107 0.94
108 0.94
109 0.92
110 0.92
111 0.91
112 0.89
113 0.87
114 0.85