Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BGT0

Protein Details
Accession A0A0P1BGT0   
Localization Confidence High
Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
81-106PLDLRPKKTRAIRRRLTKHERTQVTEHydrophilic
NLS Segment(s)
PositionSequence
71-101REHYKGKKYLPLDLRPKKTRAIRRRLTKHER
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAKGVKAHELATKNKAELTSQLEELRGELLSLRVQKVAGASSNKLAKIKGVRKGIARVLTVINAKTRASLREHYKGKKYLPLDLRPKKTRAIRRRLTKHERTQVTERQHKKDIHFNRRRYVLKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.29
4 0.28
5 0.3
6 0.27
7 0.26
8 0.27
9 0.25
10 0.24
11 0.23
12 0.2
13 0.13
14 0.09
15 0.07
16 0.08
17 0.11
18 0.13
19 0.14
20 0.13
21 0.13
22 0.14
23 0.14
24 0.14
25 0.15
26 0.15
27 0.15
28 0.19
29 0.22
30 0.23
31 0.23
32 0.21
33 0.21
34 0.27
35 0.32
36 0.35
37 0.37
38 0.39
39 0.4
40 0.44
41 0.44
42 0.39
43 0.33
44 0.27
45 0.22
46 0.22
47 0.21
48 0.18
49 0.15
50 0.12
51 0.12
52 0.12
53 0.13
54 0.13
55 0.16
56 0.21
57 0.26
58 0.34
59 0.4
60 0.43
61 0.49
62 0.52
63 0.5
64 0.51
65 0.46
66 0.45
67 0.46
68 0.5
69 0.54
70 0.58
71 0.65
72 0.64
73 0.65
74 0.64
75 0.66
76 0.67
77 0.67
78 0.69
79 0.7
80 0.76
81 0.83
82 0.87
83 0.88
84 0.87
85 0.87
86 0.87
87 0.83
88 0.79
89 0.77
90 0.74
91 0.74
92 0.74
93 0.71
94 0.68
95 0.7
96 0.68
97 0.66
98 0.68
99 0.69
100 0.71
101 0.73
102 0.73
103 0.74
104 0.78