Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P1B9X1

Protein Details
Accession A0A0P1B9X1    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-33YCKDQIPSKWPSRKKRQIANKCKCNLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito_nucl 12.833, cyto_nucl 10.333, mito 6.5
Family & Domain DBs
Amino Acid Sequences MQMCLMYCKDQIPSKWPSRKKRQIANKCKCNLESDPIVTMGADNDSSLRLGATWRDKGIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.52
3 0.6
4 0.65
5 0.71
6 0.79
7 0.82
8 0.84
9 0.85
10 0.87
11 0.89
12 0.89
13 0.87
14 0.8
15 0.75
16 0.66
17 0.59
18 0.5
19 0.43
20 0.35
21 0.27
22 0.25
23 0.22
24 0.21
25 0.16
26 0.14
27 0.1
28 0.08
29 0.06
30 0.05
31 0.05
32 0.06
33 0.06
34 0.06
35 0.06
36 0.05
37 0.07
38 0.14
39 0.2
40 0.23