Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BEV1

Protein Details
Accession A0A0P1BEV1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-114LDKAKHYGKNPPKKGQGRRAAVKGKKBasic
NLS Segment(s)
PositionSequence
92-114AKHYGKNPPKKGQGRRAAVKGKK
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MASSSINLLRSLAVARSRIFQTSTPSLSNPGGVRTGSKILRARLRGPSMLRYYPPTLNLRSVNMLGRELEGDMWRDVVDWNERQRLADLDKAKHYGKNPPKKGQGRRAAVKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.22
4 0.23
5 0.24
6 0.25
7 0.23
8 0.27
9 0.3
10 0.32
11 0.3
12 0.29
13 0.31
14 0.29
15 0.3
16 0.23
17 0.19
18 0.18
19 0.16
20 0.16
21 0.16
22 0.2
23 0.18
24 0.23
25 0.25
26 0.28
27 0.35
28 0.36
29 0.38
30 0.39
31 0.42
32 0.39
33 0.37
34 0.39
35 0.37
36 0.35
37 0.33
38 0.3
39 0.3
40 0.27
41 0.29
42 0.26
43 0.23
44 0.25
45 0.25
46 0.22
47 0.21
48 0.21
49 0.19
50 0.16
51 0.16
52 0.12
53 0.12
54 0.11
55 0.09
56 0.09
57 0.08
58 0.09
59 0.08
60 0.08
61 0.08
62 0.08
63 0.08
64 0.1
65 0.13
66 0.16
67 0.2
68 0.24
69 0.25
70 0.25
71 0.26
72 0.27
73 0.26
74 0.29
75 0.3
76 0.3
77 0.33
78 0.37
79 0.37
80 0.38
81 0.37
82 0.41
83 0.46
84 0.54
85 0.59
86 0.64
87 0.72
88 0.78
89 0.86
90 0.86
91 0.86
92 0.84
93 0.84
94 0.84