Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P1BA36

Protein Details
Accession A0A0P1BA36    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
82-101DSCYRQRRTGERRRKSVRGCBasic
184-215LITSQRLQRKRHLRSLKKRTTERQNAQKKEYEHydrophilic
NLS Segment(s)
PositionSequence
161-207IRREVTPKKEGAKPYTKAPKIQRLITSQRLQRKRHLRSLKKRTTERQ
226-241KERNAAARAQRKSTRA
Subcellular Location(s) nucl 14.5, cyto_nucl 13, cyto 8.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences MTKLNFANPATGAQKSFEIDDEHKTRVFYERRMGQEVDISQLGEEFKGYVVRIGGANDKQGFPAKQGVLAPNRVRLLLGAGDSCYRQRRTGERRRKSVRGCIMGSDIQAYHLIIVKQGEKEIPGLTDAESTVPKRLGPKRANHIRKFFNLTPKDDVRKFVIRREVTPKKEGAKPYTKAPKIQRLITSQRLQRKRHLRSLKKRTTERQNAQKKEYEVVLAKRQAEVKERNAAARAQRKSTRAAKQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.21
4 0.19
5 0.21
6 0.22
7 0.29
8 0.31
9 0.32
10 0.32
11 0.31
12 0.3
13 0.34
14 0.37
15 0.33
16 0.39
17 0.43
18 0.47
19 0.52
20 0.51
21 0.43
22 0.43
23 0.39
24 0.34
25 0.27
26 0.22
27 0.17
28 0.17
29 0.17
30 0.11
31 0.1
32 0.07
33 0.07
34 0.08
35 0.09
36 0.09
37 0.09
38 0.1
39 0.1
40 0.12
41 0.16
42 0.16
43 0.2
44 0.2
45 0.2
46 0.21
47 0.25
48 0.24
49 0.21
50 0.26
51 0.22
52 0.23
53 0.25
54 0.28
55 0.27
56 0.34
57 0.33
58 0.32
59 0.32
60 0.29
61 0.27
62 0.22
63 0.2
64 0.14
65 0.14
66 0.09
67 0.09
68 0.1
69 0.11
70 0.14
71 0.17
72 0.17
73 0.19
74 0.23
75 0.32
76 0.42
77 0.52
78 0.6
79 0.64
80 0.72
81 0.77
82 0.82
83 0.77
84 0.75
85 0.73
86 0.68
87 0.59
88 0.51
89 0.46
90 0.39
91 0.34
92 0.26
93 0.17
94 0.12
95 0.11
96 0.1
97 0.07
98 0.08
99 0.08
100 0.07
101 0.09
102 0.09
103 0.09
104 0.1
105 0.1
106 0.08
107 0.09
108 0.09
109 0.08
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.07
116 0.08
117 0.08
118 0.09
119 0.09
120 0.1
121 0.16
122 0.21
123 0.3
124 0.35
125 0.4
126 0.49
127 0.6
128 0.69
129 0.68
130 0.7
131 0.65
132 0.63
133 0.65
134 0.59
135 0.58
136 0.52
137 0.5
138 0.49
139 0.49
140 0.51
141 0.44
142 0.43
143 0.38
144 0.43
145 0.41
146 0.4
147 0.45
148 0.4
149 0.43
150 0.51
151 0.55
152 0.51
153 0.53
154 0.52
155 0.47
156 0.51
157 0.52
158 0.5
159 0.5
160 0.47
161 0.52
162 0.59
163 0.57
164 0.58
165 0.61
166 0.63
167 0.59
168 0.62
169 0.58
170 0.56
171 0.6
172 0.61
173 0.61
174 0.57
175 0.62
176 0.65
177 0.64
178 0.66
179 0.69
180 0.69
181 0.72
182 0.77
183 0.78
184 0.81
185 0.89
186 0.89
187 0.88
188 0.89
189 0.88
190 0.88
191 0.88
192 0.87
193 0.86
194 0.86
195 0.84
196 0.8
197 0.77
198 0.68
199 0.61
200 0.52
201 0.47
202 0.42
203 0.41
204 0.44
205 0.42
206 0.41
207 0.4
208 0.43
209 0.41
210 0.44
211 0.45
212 0.42
213 0.47
214 0.48
215 0.48
216 0.46
217 0.47
218 0.48
219 0.51
220 0.5
221 0.49
222 0.54
223 0.54
224 0.6
225 0.65