Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BNL7

Protein Details
Accession A0A0P1BNL7   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-37SFGKRHTKTHTLCRRCNRRAFHKQHKTCASCHydrophilic
NLS Segment(s)
PositionSequence
53-57AKRRK
Subcellular Location(s) nucl 11, mito 8, cyto 8, cyto_mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences MTKGTTSFGKRHTKTHTLCRRCNRRAFHKQHKTCASCGYPAAKIRSYEWGQKAKRRKTTGTGRMRYLSTVPRRAKNGFQTGVAKRQKKPSAAAASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.71
4 0.69
5 0.76
6 0.8
7 0.82
8 0.81
9 0.83
10 0.81
11 0.81
12 0.83
13 0.84
14 0.85
15 0.85
16 0.83
17 0.84
18 0.85
19 0.77
20 0.67
21 0.64
22 0.54
23 0.44
24 0.4
25 0.33
26 0.27
27 0.28
28 0.3
29 0.25
30 0.24
31 0.24
32 0.28
33 0.28
34 0.31
35 0.32
36 0.38
37 0.38
38 0.44
39 0.53
40 0.54
41 0.61
42 0.6
43 0.58
44 0.58
45 0.66
46 0.7
47 0.71
48 0.67
49 0.62
50 0.59
51 0.56
52 0.49
53 0.41
54 0.39
55 0.36
56 0.42
57 0.44
58 0.46
59 0.51
60 0.53
61 0.57
62 0.56
63 0.57
64 0.5
65 0.49
66 0.51
67 0.5
68 0.57
69 0.59
70 0.56
71 0.53
72 0.61
73 0.64
74 0.61
75 0.62
76 0.62