Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BEU7

Protein Details
Accession A0A0P1BEU7   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
41-71GADHLRTRGRKERQRQRSRSRTPRVPSKRLHBasic
NLS Segment(s)
PositionSequence
47-69TRGRKERQRQRSRSRTPRVPSKR
Subcellular Location(s) nucl 17, mito_nucl 11.999, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MLSVNKLDAYHVPLLDRAALARRSAPDNKTLPVIVPSYCGGADHLRTRGRKERQRQRSRSRTPRVPSKRLHVEPLEIPRYPGPISQGDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.17
4 0.13
5 0.15
6 0.16
7 0.16
8 0.17
9 0.19
10 0.23
11 0.29
12 0.29
13 0.31
14 0.32
15 0.32
16 0.32
17 0.3
18 0.25
19 0.22
20 0.21
21 0.14
22 0.13
23 0.13
24 0.12
25 0.11
26 0.11
27 0.1
28 0.1
29 0.12
30 0.12
31 0.16
32 0.19
33 0.2
34 0.25
35 0.33
36 0.41
37 0.47
38 0.56
39 0.63
40 0.7
41 0.8
42 0.86
43 0.87
44 0.89
45 0.91
46 0.91
47 0.9
48 0.88
49 0.84
50 0.86
51 0.84
52 0.81
53 0.76
54 0.74
55 0.75
56 0.69
57 0.68
58 0.59
59 0.55
60 0.52
61 0.56
62 0.51
63 0.41
64 0.4
65 0.35
66 0.35
67 0.32
68 0.28
69 0.24