Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1B7N4

Protein Details
Accession A0A0P1B7N4   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
96-118ASDPYRRRSRCSKRSMSRRHADHBasic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 5, E.R. 3, golg 3, nucl 2
Family & Domain DBs
Amino Acid Sequences MRSAGISVFVVVLTTALASAAANASSSNPEPSAEVPKIHIGTPVNLDQDSASPELNDNVAATDIPKVHLGIKPNQALHFDSPKVHVGTPAQGSTAASDPYRRRSRCSKRSMSRRHADHVEGENKMLERSHLSEKDQKYKQKLERIEWAKEQARHPPESYEEDGEHPLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.04
5 0.03
6 0.04
7 0.05
8 0.05
9 0.05
10 0.05
11 0.06
12 0.1
13 0.11
14 0.12
15 0.12
16 0.13
17 0.14
18 0.16
19 0.22
20 0.21
21 0.2
22 0.21
23 0.25
24 0.26
25 0.24
26 0.26
27 0.2
28 0.21
29 0.24
30 0.24
31 0.21
32 0.2
33 0.2
34 0.16
35 0.16
36 0.16
37 0.13
38 0.1
39 0.09
40 0.1
41 0.1
42 0.1
43 0.09
44 0.06
45 0.06
46 0.06
47 0.06
48 0.05
49 0.07
50 0.07
51 0.08
52 0.08
53 0.09
54 0.1
55 0.12
56 0.15
57 0.19
58 0.24
59 0.27
60 0.27
61 0.28
62 0.28
63 0.28
64 0.27
65 0.25
66 0.2
67 0.18
68 0.19
69 0.2
70 0.2
71 0.18
72 0.16
73 0.13
74 0.16
75 0.16
76 0.14
77 0.12
78 0.11
79 0.11
80 0.11
81 0.11
82 0.09
83 0.08
84 0.13
85 0.14
86 0.23
87 0.32
88 0.32
89 0.36
90 0.46
91 0.57
92 0.62
93 0.7
94 0.72
95 0.73
96 0.83
97 0.89
98 0.87
99 0.85
100 0.79
101 0.76
102 0.69
103 0.6
104 0.55
105 0.52
106 0.46
107 0.38
108 0.34
109 0.3
110 0.26
111 0.25
112 0.19
113 0.14
114 0.12
115 0.16
116 0.23
117 0.24
118 0.29
119 0.36
120 0.42
121 0.51
122 0.55
123 0.58
124 0.58
125 0.65
126 0.69
127 0.7
128 0.71
129 0.67
130 0.71
131 0.69
132 0.68
133 0.62
134 0.63
135 0.6
136 0.58
137 0.56
138 0.55
139 0.54
140 0.53
141 0.5
142 0.46
143 0.44
144 0.45
145 0.47
146 0.41
147 0.37
148 0.35