Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BBW9

Protein Details
Accession A0A0P1BBW9   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-33DSAANEKPRGPPKKKTKPEKDDEGNEEAcidic
NLS Segment(s)
PositionSequence
13-25KPRGPPKKKTKPE
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF13921  Myb_DNA-bind_6  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
CDD cd00167  SANT  
Amino Acid Sequences MSLRSVDSAANEKPRGPPKKKTKPEKDDEGNEEEDSKQQSGKPKRGKVEAWTAEQRKALVLSMCASSFSHMDWNEVSAQCGGRTVPQVKMYWRNVLKAKLEKALEEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.52
3 0.54
4 0.6
5 0.64
6 0.74
7 0.83
8 0.86
9 0.88
10 0.87
11 0.89
12 0.89
13 0.86
14 0.81
15 0.76
16 0.69
17 0.6
18 0.5
19 0.43
20 0.33
21 0.27
22 0.22
23 0.18
24 0.14
25 0.14
26 0.24
27 0.3
28 0.4
29 0.46
30 0.5
31 0.54
32 0.58
33 0.58
34 0.53
35 0.55
36 0.49
37 0.45
38 0.47
39 0.44
40 0.41
41 0.39
42 0.34
43 0.24
44 0.21
45 0.18
46 0.1
47 0.1
48 0.09
49 0.09
50 0.09
51 0.1
52 0.09
53 0.09
54 0.09
55 0.09
56 0.13
57 0.12
58 0.13
59 0.13
60 0.14
61 0.17
62 0.16
63 0.17
64 0.13
65 0.14
66 0.12
67 0.13
68 0.12
69 0.11
70 0.17
71 0.18
72 0.21
73 0.25
74 0.27
75 0.32
76 0.41
77 0.42
78 0.46
79 0.46
80 0.48
81 0.5
82 0.53
83 0.56
84 0.55
85 0.56
86 0.53
87 0.52