Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BSY5

Protein Details
Accession A0A0P1BSY5   
Localization Confidence Low
Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
136-165FVAFKKRDTIRQWSRQRRMKKIGVSYKKEDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8plas 8, extr 3, E.R. 3, cyto 2, nucl 1, pero 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR008928  6-hairpin_glycosidase_sf  
IPR012341  6hp_glycosidase-like_sf  
IPR001701  Glyco_hydro_9  
Gene Ontology GO:0016020  C:membrane  
GO:0008810  F:cellulase activity  
GO:0030245  P:cellulose catabolic process  
Pfam View protein in Pfam  
PF00759  Glyco_hydro_9  
Amino Acid Sequences MLQAAVLRPELSSVFNVDTLRDKSEVWLDAAVDNKMSSFFYTPGALPWWKGDSDGTSMNPMMNAAFLSAIYGPFARGSKVNKYAGWTNFLIDYVLGKNPMNTPRKVAKRPKSSSQVALEAALPTVFIVLALAIAGFVAFKKRDTIRQWSRQRRMKKIGVSYKKEDFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.17
4 0.17
5 0.22
6 0.22
7 0.24
8 0.22
9 0.21
10 0.21
11 0.25
12 0.25
13 0.21
14 0.2
15 0.17
16 0.18
17 0.2
18 0.18
19 0.13
20 0.12
21 0.1
22 0.1
23 0.1
24 0.1
25 0.09
26 0.1
27 0.11
28 0.13
29 0.13
30 0.14
31 0.17
32 0.16
33 0.14
34 0.16
35 0.16
36 0.14
37 0.15
38 0.14
39 0.13
40 0.15
41 0.17
42 0.15
43 0.15
44 0.15
45 0.14
46 0.14
47 0.12
48 0.08
49 0.07
50 0.06
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.07
63 0.09
64 0.12
65 0.17
66 0.23
67 0.24
68 0.24
69 0.26
70 0.31
71 0.3
72 0.31
73 0.25
74 0.2
75 0.19
76 0.18
77 0.15
78 0.09
79 0.09
80 0.07
81 0.07
82 0.08
83 0.08
84 0.09
85 0.12
86 0.2
87 0.24
88 0.23
89 0.28
90 0.35
91 0.43
92 0.51
93 0.58
94 0.6
95 0.67
96 0.72
97 0.76
98 0.75
99 0.71
100 0.68
101 0.61
102 0.55
103 0.45
104 0.39
105 0.32
106 0.24
107 0.2
108 0.13
109 0.09
110 0.06
111 0.05
112 0.04
113 0.03
114 0.03
115 0.02
116 0.03
117 0.03
118 0.02
119 0.02
120 0.02
121 0.02
122 0.02
123 0.03
124 0.07
125 0.08
126 0.09
127 0.15
128 0.18
129 0.27
130 0.33
131 0.43
132 0.5
133 0.6
134 0.7
135 0.76
136 0.83
137 0.84
138 0.88
139 0.88
140 0.87
141 0.85
142 0.83
143 0.83
144 0.83
145 0.85
146 0.83
147 0.79