Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BQ65

Protein Details
Accession A0A0P1BQ65    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
45-71DFLRRLRIRAHARKRCKISTRRCDVCAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
Amino Acid Sequences MEELERFLRETDPDWPGDDDEEALGADVRTTPRPSSSTFDDDFDDFLRRLRIRAHARKRCKISTRRCDVCAKRPSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.22
5 0.2
6 0.14
7 0.11
8 0.1
9 0.08
10 0.07
11 0.06
12 0.05
13 0.04
14 0.05
15 0.07
16 0.09
17 0.11
18 0.11
19 0.13
20 0.15
21 0.18
22 0.21
23 0.24
24 0.26
25 0.26
26 0.26
27 0.26
28 0.24
29 0.22
30 0.19
31 0.16
32 0.12
33 0.12
34 0.16
35 0.15
36 0.16
37 0.18
38 0.26
39 0.35
40 0.46
41 0.56
42 0.61
43 0.7
44 0.78
45 0.83
46 0.83
47 0.83
48 0.82
49 0.82
50 0.83
51 0.84
52 0.81
53 0.78
54 0.79
55 0.76
56 0.76