Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P1BGG8

Protein Details
Accession A0A0P1BGG8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
10-32SSLPASPQPQRRKRQTKDLGTDDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MPRFWQRPSSSLPASPQPQRRKRQTKDLGTDDGREASLRISVPKEAKAAVSDKVGGTTAVILG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.52
4 0.56
5 0.62
6 0.68
7 0.75
8 0.78
9 0.79
10 0.82
11 0.83
12 0.82
13 0.8
14 0.76
15 0.71
16 0.61
17 0.57
18 0.46
19 0.37
20 0.27
21 0.19
22 0.14
23 0.09
24 0.09
25 0.08
26 0.09
27 0.1
28 0.14
29 0.16
30 0.18
31 0.19
32 0.18
33 0.18
34 0.19
35 0.2
36 0.18
37 0.18
38 0.18
39 0.17
40 0.17
41 0.17
42 0.14
43 0.12