Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3JFV3

Protein Details
Accession G3JFV3    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
83-104SPCKVVKRSGGGRKRKQPEEEEBasic
NLS Segment(s)
PositionSequence
86-98KVVKRSGGGRKRK
Subcellular Location(s) nucl 11, cyto 9, mito 6
Family & Domain DBs
KEGG cmt:CCM_04559  -  
Amino Acid Sequences MANEEKMVLTDGEMRILKAIFANLNSKPDVDWDTAAVDASLGNAKSIKERYRQMCVRLGWNKPRPSGGGSAPVTPIKTKKTASPCKVVKRSGGGRKRKQPEEEEEEEAEEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.17
5 0.13
6 0.15
7 0.11
8 0.13
9 0.17
10 0.17
11 0.2
12 0.2
13 0.19
14 0.18
15 0.18
16 0.2
17 0.17
18 0.16
19 0.14
20 0.14
21 0.14
22 0.14
23 0.11
24 0.07
25 0.05
26 0.05
27 0.06
28 0.06
29 0.06
30 0.07
31 0.07
32 0.11
33 0.15
34 0.18
35 0.21
36 0.28
37 0.32
38 0.39
39 0.42
40 0.42
41 0.44
42 0.42
43 0.45
44 0.43
45 0.45
46 0.46
47 0.51
48 0.51
49 0.46
50 0.46
51 0.4
52 0.37
53 0.35
54 0.27
55 0.28
56 0.25
57 0.25
58 0.25
59 0.25
60 0.23
61 0.21
62 0.23
63 0.18
64 0.22
65 0.22
66 0.27
67 0.37
68 0.47
69 0.5
70 0.57
71 0.61
72 0.67
73 0.73
74 0.69
75 0.63
76 0.61
77 0.65
78 0.66
79 0.68
80 0.68
81 0.71
82 0.79
83 0.83
84 0.83
85 0.81
86 0.78
87 0.78
88 0.75
89 0.71
90 0.66
91 0.57
92 0.51