Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0N7L927

Protein Details
Accession A0A0N7L927    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-63YHFDFFRRSVRRRARNANRVTGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 7, mito 4, cyto_pero 4
Family & Domain DBs
Amino Acid Sequences MSLSSSVEKSPLFFPHLFMILYEDLAISSQGSDRSLYMQREYHFDFFRRSVRRRARNANRVTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.25
4 0.22
5 0.19
6 0.2
7 0.15
8 0.14
9 0.12
10 0.09
11 0.07
12 0.08
13 0.08
14 0.04
15 0.04
16 0.05
17 0.05
18 0.06
19 0.06
20 0.06
21 0.09
22 0.14
23 0.15
24 0.17
25 0.2
26 0.2
27 0.24
28 0.28
29 0.29
30 0.28
31 0.28
32 0.3
33 0.3
34 0.38
35 0.42
36 0.42
37 0.48
38 0.56
39 0.64
40 0.7
41 0.78
42 0.81
43 0.83