Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3JJL7

Protein Details
Accession G3JJL7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-84HSSVKKRCEHCKVVRRKAGKRHNGYLBasic
NLS Segment(s)
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cmt:CCM_05415  -  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MASLFRTLTLSASAFSSRALFAAPASFLAGGRVAGALSPFSRALAVVTTTTQVRGMKVHSSVKKRCEHCKVVRRKAGKRHNGYLYIICKANPRHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.1
5 0.1
6 0.1
7 0.08
8 0.07
9 0.09
10 0.08
11 0.07
12 0.08
13 0.08
14 0.07
15 0.08
16 0.08
17 0.06
18 0.06
19 0.06
20 0.05
21 0.04
22 0.05
23 0.05
24 0.05
25 0.07
26 0.06
27 0.06
28 0.07
29 0.06
30 0.07
31 0.06
32 0.07
33 0.06
34 0.06
35 0.07
36 0.07
37 0.07
38 0.09
39 0.09
40 0.08
41 0.09
42 0.1
43 0.12
44 0.16
45 0.23
46 0.27
47 0.35
48 0.4
49 0.47
50 0.53
51 0.55
52 0.61
53 0.62
54 0.65
55 0.67
56 0.72
57 0.75
58 0.78
59 0.81
60 0.81
61 0.81
62 0.82
63 0.83
64 0.83
65 0.8
66 0.79
67 0.77
68 0.72
69 0.67
70 0.64
71 0.57
72 0.5
73 0.43
74 0.35
75 0.35
76 0.39
77 0.45
78 0.48
79 0.54