Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3JUA2

Protein Details
Accession G3JUA2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
106-125TTGHKKWRKTYYRHNTRPGSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR005822  Ribosomal_L13  
IPR005823  Ribosomal_L13_bac-type  
IPR036899  Ribosomal_L13_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cmt:CCM_09431  -  
Pfam View protein in Pfam  
PF00572  Ribosomal_L13  
CDD cd00392  Ribosomal_L13  
Amino Acid Sequences MSQVIGTTRLAYSRVWHQVSAKAPHAGLTTKKAAVAAAAAAAATTNTTRPTPLSATTADTDVTPPSLGRLASRIAVLLMGKHKPTFDPSTDCGDYVVVTDCAALHTTGHKKWRKTYYRHNTRPGSLRAVTMDVLMEKHGGAEVLRKAVSGMLPKNRLRDRRLARLKAFEGGAHPYADNIVRFGGVPVGDRGWEAVVESIRAADKERL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.33
4 0.34
5 0.39
6 0.46
7 0.48
8 0.44
9 0.37
10 0.35
11 0.36
12 0.35
13 0.32
14 0.29
15 0.28
16 0.28
17 0.26
18 0.27
19 0.25
20 0.22
21 0.19
22 0.17
23 0.11
24 0.07
25 0.06
26 0.05
27 0.05
28 0.05
29 0.04
30 0.04
31 0.04
32 0.05
33 0.07
34 0.08
35 0.09
36 0.1
37 0.14
38 0.15
39 0.17
40 0.19
41 0.18
42 0.21
43 0.21
44 0.21
45 0.18
46 0.15
47 0.14
48 0.12
49 0.11
50 0.08
51 0.07
52 0.07
53 0.09
54 0.09
55 0.08
56 0.1
57 0.1
58 0.11
59 0.11
60 0.1
61 0.08
62 0.09
63 0.08
64 0.08
65 0.1
66 0.11
67 0.12
68 0.13
69 0.13
70 0.13
71 0.18
72 0.2
73 0.19
74 0.23
75 0.24
76 0.31
77 0.31
78 0.3
79 0.25
80 0.21
81 0.19
82 0.14
83 0.13
84 0.06
85 0.06
86 0.06
87 0.05
88 0.06
89 0.06
90 0.05
91 0.04
92 0.08
93 0.12
94 0.14
95 0.23
96 0.28
97 0.3
98 0.37
99 0.48
100 0.52
101 0.56
102 0.65
103 0.67
104 0.74
105 0.8
106 0.81
107 0.74
108 0.7
109 0.7
110 0.62
111 0.56
112 0.46
113 0.39
114 0.31
115 0.29
116 0.24
117 0.18
118 0.15
119 0.09
120 0.08
121 0.08
122 0.07
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.09
129 0.1
130 0.12
131 0.12
132 0.12
133 0.12
134 0.13
135 0.15
136 0.16
137 0.2
138 0.25
139 0.32
140 0.34
141 0.43
142 0.49
143 0.54
144 0.53
145 0.58
146 0.58
147 0.63
148 0.71
149 0.71
150 0.68
151 0.69
152 0.66
153 0.59
154 0.53
155 0.42
156 0.34
157 0.31
158 0.28
159 0.21
160 0.19
161 0.16
162 0.17
163 0.18
164 0.16
165 0.12
166 0.11
167 0.1
168 0.11
169 0.11
170 0.12
171 0.1
172 0.11
173 0.12
174 0.13
175 0.13
176 0.12
177 0.13
178 0.11
179 0.11
180 0.1
181 0.11
182 0.11
183 0.12
184 0.12
185 0.13
186 0.13
187 0.14