Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3JHA4

Protein Details
Accession G3JHA4    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
160-179KYASIQKKKASGKKAFYQKVHydrophilic
NLS Segment(s)
PositionSequence
166-188KKKASGKKAFYQKVVAQRRKGRG
Subcellular Location(s) cyto 11, nucl 8.5, mito_nucl 7.5, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039883  Fcf2/DNTTIP2  
IPR014810  Fcf2_C  
Gene Ontology GO:0005634  C:nucleus  
KEGG cmt:CCM_05818  -  
Pfam View protein in Pfam  
PF08698  Fcf2  
Amino Acid Sequences MAKLSSHQMSELLLQAERCLAGNPKTVELSDVALDKVEAIAPVIATVPKGKEGSIRVAKKEKTSTTEAKDSAGCNWFDLPKTVLTPEFRRDWQVLRMRGLLDPKHQKKALRAEAPKYSQVGQIIEGPADFFSARLTRKERRQTILGEVMRDYSDDKIRTKYASIQKKKASGKKAFYQKVVAQRRKGRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.14
5 0.13
6 0.12
7 0.14
8 0.16
9 0.24
10 0.25
11 0.27
12 0.27
13 0.27
14 0.26
15 0.23
16 0.21
17 0.15
18 0.15
19 0.12
20 0.11
21 0.11
22 0.09
23 0.09
24 0.07
25 0.06
26 0.05
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.06
33 0.08
34 0.08
35 0.11
36 0.12
37 0.12
38 0.15
39 0.18
40 0.26
41 0.34
42 0.36
43 0.38
44 0.45
45 0.47
46 0.48
47 0.52
48 0.46
49 0.42
50 0.45
51 0.46
52 0.44
53 0.48
54 0.42
55 0.38
56 0.36
57 0.32
58 0.28
59 0.25
60 0.2
61 0.15
62 0.16
63 0.16
64 0.15
65 0.15
66 0.13
67 0.11
68 0.12
69 0.12
70 0.13
71 0.15
72 0.18
73 0.2
74 0.21
75 0.21
76 0.23
77 0.24
78 0.23
79 0.28
80 0.32
81 0.31
82 0.3
83 0.31
84 0.28
85 0.29
86 0.3
87 0.24
88 0.24
89 0.33
90 0.34
91 0.39
92 0.41
93 0.42
94 0.44
95 0.53
96 0.54
97 0.53
98 0.53
99 0.52
100 0.56
101 0.57
102 0.52
103 0.44
104 0.36
105 0.29
106 0.27
107 0.23
108 0.17
109 0.17
110 0.16
111 0.14
112 0.12
113 0.11
114 0.09
115 0.09
116 0.08
117 0.05
118 0.07
119 0.1
120 0.12
121 0.17
122 0.23
123 0.29
124 0.39
125 0.49
126 0.54
127 0.55
128 0.59
129 0.57
130 0.58
131 0.6
132 0.52
133 0.44
134 0.38
135 0.34
136 0.29
137 0.26
138 0.21
139 0.15
140 0.19
141 0.21
142 0.23
143 0.26
144 0.28
145 0.29
146 0.3
147 0.36
148 0.4
149 0.48
150 0.54
151 0.59
152 0.64
153 0.71
154 0.78
155 0.77
156 0.77
157 0.76
158 0.75
159 0.75
160 0.8
161 0.77
162 0.71
163 0.7
164 0.66
165 0.67
166 0.71
167 0.69
168 0.68