Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3JJ83

Protein Details
Accession G3JJ83   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
56-79LTVGGRTTPKKKKKNQIKNCIAIAHydrophilic
NLS Segment(s)
PositionSequence
64-69PKKKKK
Subcellular Location(s) nucl 15, extr 6, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
KEGG cmt:CCM_06185  -  
Amino Acid Sequences MTQPAPASLLGLSLPASVDFAPDAPNQRAPYRTACGSAQNKHLLPTPINTRWAAPLTVGGRTTPKKKKKNQIKNCIAIAHAPRLQHLYPATRRHMHPASYSSEPQQTPPTANVFRRGFLPFACPVKRTIGHTSSADRSESLYAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.08
4 0.07
5 0.08
6 0.07
7 0.07
8 0.1
9 0.12
10 0.17
11 0.18
12 0.24
13 0.26
14 0.28
15 0.3
16 0.3
17 0.33
18 0.33
19 0.32
20 0.3
21 0.29
22 0.35
23 0.39
24 0.4
25 0.4
26 0.4
27 0.39
28 0.38
29 0.41
30 0.34
31 0.29
32 0.3
33 0.32
34 0.3
35 0.32
36 0.31
37 0.27
38 0.27
39 0.27
40 0.23
41 0.15
42 0.17
43 0.15
44 0.16
45 0.15
46 0.13
47 0.16
48 0.19
49 0.28
50 0.33
51 0.42
52 0.5
53 0.59
54 0.69
55 0.76
56 0.84
57 0.86
58 0.88
59 0.86
60 0.82
61 0.75
62 0.65
63 0.54
64 0.47
65 0.38
66 0.31
67 0.25
68 0.19
69 0.18
70 0.21
71 0.21
72 0.2
73 0.19
74 0.22
75 0.26
76 0.31
77 0.36
78 0.36
79 0.37
80 0.42
81 0.44
82 0.39
83 0.37
84 0.35
85 0.35
86 0.35
87 0.35
88 0.3
89 0.33
90 0.31
91 0.29
92 0.31
93 0.27
94 0.25
95 0.26
96 0.3
97 0.3
98 0.32
99 0.38
100 0.35
101 0.34
102 0.35
103 0.35
104 0.29
105 0.24
106 0.27
107 0.24
108 0.3
109 0.31
110 0.29
111 0.29
112 0.35
113 0.37
114 0.38
115 0.41
116 0.37
117 0.39
118 0.42
119 0.45
120 0.43
121 0.42
122 0.38
123 0.3
124 0.29