Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3J9P4

Protein Details
Accession G3J9P4   
Localization Confidence High
Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
31-52PDGPWRRKVTKIKKDLIHKAKVBasic
NLS Segment(s)
PositionSequence
6-62AKKPVGDNETGKKHRKGFRVGPDNLPDGPWRRKVTKIKKDLIHKAKVKKAYAKIKHR
168-190RDRFKKAMAKTVGRDGKKKLGRE
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
KEGG cmt:CCM_02441  -  
Amino Acid Sequences MAPKPAKKPVGDNETGKKHRKGFRVGPDNLPDGPWRRKVTKIKKDLIHKAKVKKAYAKIKHRGQEETADGEAQQDTAGADKDVEEDGANEVMHPTRELMIKVESVAQNPAQVQGAGEGTSDGHRRRTRRPGYYDKQLAQAEERRAETEERAQAYEARMAERTARLAERDRFKKAMAKTVGRDGKKKLGRESGILLDKVKRLVAKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.71
3 0.7
4 0.67
5 0.67
6 0.68
7 0.7
8 0.7
9 0.69
10 0.73
11 0.76
12 0.73
13 0.72
14 0.69
15 0.64
16 0.55
17 0.47
18 0.4
19 0.37
20 0.39
21 0.39
22 0.4
23 0.4
24 0.49
25 0.59
26 0.66
27 0.7
28 0.73
29 0.74
30 0.75
31 0.82
32 0.83
33 0.81
34 0.79
35 0.76
36 0.75
37 0.73
38 0.74
39 0.69
40 0.67
41 0.67
42 0.69
43 0.71
44 0.73
45 0.75
46 0.75
47 0.76
48 0.71
49 0.66
50 0.57
51 0.53
52 0.45
53 0.39
54 0.32
55 0.26
56 0.23
57 0.2
58 0.17
59 0.11
60 0.09
61 0.05
62 0.04
63 0.05
64 0.06
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.06
74 0.07
75 0.07
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.07
83 0.08
84 0.08
85 0.09
86 0.1
87 0.1
88 0.1
89 0.13
90 0.11
91 0.11
92 0.12
93 0.11
94 0.11
95 0.11
96 0.11
97 0.08
98 0.08
99 0.07
100 0.06
101 0.07
102 0.06
103 0.06
104 0.05
105 0.05
106 0.07
107 0.1
108 0.1
109 0.18
110 0.22
111 0.26
112 0.33
113 0.44
114 0.51
115 0.56
116 0.64
117 0.67
118 0.69
119 0.76
120 0.74
121 0.65
122 0.64
123 0.56
124 0.48
125 0.42
126 0.41
127 0.35
128 0.32
129 0.31
130 0.26
131 0.27
132 0.27
133 0.25
134 0.25
135 0.26
136 0.25
137 0.25
138 0.24
139 0.25
140 0.25
141 0.27
142 0.21
143 0.18
144 0.17
145 0.16
146 0.19
147 0.18
148 0.18
149 0.17
150 0.18
151 0.2
152 0.26
153 0.33
154 0.4
155 0.44
156 0.47
157 0.46
158 0.47
159 0.51
160 0.47
161 0.49
162 0.47
163 0.49
164 0.47
165 0.55
166 0.61
167 0.58
168 0.6
169 0.56
170 0.58
171 0.58
172 0.6
173 0.58
174 0.59
175 0.58
176 0.57
177 0.57
178 0.55
179 0.54
180 0.49
181 0.44
182 0.38
183 0.38
184 0.36
185 0.34