Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3JJP1

Protein Details
Accession G3JJP1    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-29IGPQLPPQPSSKRKRTPEPPDNDENGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022226  DUF3752  
IPR046331  GPAM1-like  
KEGG cmt:CCM_05439  -  
Pfam View protein in Pfam  
PF12572  DUF3752  
Amino Acid Sequences MSSIGPQLPPQPSSKRKRTPEPPDNDENGAAAPKHTRRNANEIDLDDASSDSDDEYGPRAPAAPTASRPSLGPSLPPPAAQNTNEISLDDSDSDSGPAPPPSAPPAKQPATAPDSDSDSDDDYGPALPSASNARHKPIGPAMPPSSGSPSAPVRDEWMLAPPVNNGYTERDPTKLKARKFTSKPFASASSGGGGGGGDLAAIWTETPEEKLKRLQDAVLGRSDGSGGQAAAVTEARSRDEEARNRKIAASIAATRGKSLYDEHQGAKEKRSDVGGRRGKAGEDEDDDPSKRAFDREKDMALGSKIGTAQRRELVAKSANFGGRFQKGSFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.69
3 0.74
4 0.82
5 0.87
6 0.88
7 0.88
8 0.87
9 0.84
10 0.83
11 0.78
12 0.7
13 0.6
14 0.49
15 0.4
16 0.33
17 0.25
18 0.18
19 0.21
20 0.24
21 0.33
22 0.38
23 0.46
24 0.48
25 0.57
26 0.62
27 0.61
28 0.6
29 0.53
30 0.52
31 0.44
32 0.39
33 0.3
34 0.24
35 0.17
36 0.13
37 0.11
38 0.06
39 0.06
40 0.06
41 0.07
42 0.09
43 0.1
44 0.1
45 0.1
46 0.11
47 0.11
48 0.14
49 0.18
50 0.19
51 0.21
52 0.27
53 0.28
54 0.27
55 0.27
56 0.28
57 0.28
58 0.25
59 0.24
60 0.21
61 0.26
62 0.26
63 0.26
64 0.23
65 0.24
66 0.28
67 0.26
68 0.28
69 0.23
70 0.25
71 0.25
72 0.23
73 0.2
74 0.16
75 0.17
76 0.13
77 0.11
78 0.1
79 0.1
80 0.1
81 0.09
82 0.09
83 0.1
84 0.1
85 0.11
86 0.1
87 0.12
88 0.16
89 0.2
90 0.2
91 0.24
92 0.31
93 0.32
94 0.34
95 0.34
96 0.35
97 0.34
98 0.34
99 0.3
100 0.24
101 0.25
102 0.24
103 0.24
104 0.19
105 0.15
106 0.16
107 0.14
108 0.13
109 0.09
110 0.09
111 0.08
112 0.07
113 0.06
114 0.05
115 0.06
116 0.09
117 0.12
118 0.18
119 0.19
120 0.22
121 0.25
122 0.25
123 0.27
124 0.29
125 0.31
126 0.26
127 0.3
128 0.29
129 0.27
130 0.28
131 0.26
132 0.24
133 0.2
134 0.18
135 0.16
136 0.16
137 0.16
138 0.16
139 0.15
140 0.14
141 0.14
142 0.15
143 0.12
144 0.13
145 0.13
146 0.12
147 0.12
148 0.1
149 0.11
150 0.1
151 0.1
152 0.09
153 0.12
154 0.13
155 0.16
156 0.16
157 0.18
158 0.18
159 0.2
160 0.3
161 0.31
162 0.32
163 0.39
164 0.44
165 0.51
166 0.56
167 0.62
168 0.62
169 0.58
170 0.58
171 0.51
172 0.48
173 0.41
174 0.36
175 0.28
176 0.19
177 0.16
178 0.14
179 0.11
180 0.08
181 0.06
182 0.04
183 0.03
184 0.02
185 0.02
186 0.02
187 0.02
188 0.02
189 0.02
190 0.02
191 0.03
192 0.04
193 0.06
194 0.11
195 0.12
196 0.14
197 0.2
198 0.22
199 0.25
200 0.26
201 0.25
202 0.26
203 0.28
204 0.29
205 0.26
206 0.24
207 0.2
208 0.19
209 0.19
210 0.13
211 0.1
212 0.08
213 0.06
214 0.06
215 0.06
216 0.06
217 0.07
218 0.07
219 0.06
220 0.07
221 0.08
222 0.09
223 0.1
224 0.13
225 0.18
226 0.25
227 0.34
228 0.41
229 0.48
230 0.49
231 0.49
232 0.48
233 0.43
234 0.37
235 0.32
236 0.28
237 0.23
238 0.26
239 0.29
240 0.28
241 0.27
242 0.26
243 0.23
244 0.2
245 0.19
246 0.19
247 0.22
248 0.25
249 0.27
250 0.32
251 0.4
252 0.41
253 0.43
254 0.43
255 0.37
256 0.36
257 0.4
258 0.4
259 0.39
260 0.48
261 0.51
262 0.47
263 0.5
264 0.49
265 0.44
266 0.41
267 0.38
268 0.31
269 0.28
270 0.29
271 0.29
272 0.32
273 0.32
274 0.3
275 0.27
276 0.24
277 0.21
278 0.24
279 0.27
280 0.3
281 0.37
282 0.41
283 0.43
284 0.43
285 0.44
286 0.42
287 0.36
288 0.32
289 0.23
290 0.2
291 0.2
292 0.23
293 0.27
294 0.26
295 0.3
296 0.32
297 0.35
298 0.35
299 0.35
300 0.37
301 0.39
302 0.37
303 0.36
304 0.38
305 0.38
306 0.37
307 0.38
308 0.38
309 0.35
310 0.37