Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0U5G3P0

Protein Details
Accession A0A0U5G3P0    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-22KSKNASQHHRSQKAHRNGIKHydrophilic
NLS Segment(s)
PositionSequence
11-64HRSQKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTAKALKERKEGKREI
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNASQHHRSQKAHRNGIKKPKTNRYPSLKGVDPKFRRNHRHALHGTAKALKERKEGKREIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.82
4 0.77
5 0.74
6 0.73
7 0.8
8 0.79
9 0.77
10 0.75
11 0.76
12 0.78
13 0.79
14 0.79
15 0.77
16 0.73
17 0.7
18 0.66
19 0.6
20 0.55
21 0.52
22 0.53
23 0.48
24 0.5
25 0.54
26 0.58
27 0.62
28 0.63
29 0.69
30 0.63
31 0.68
32 0.63
33 0.63
34 0.62
35 0.57
36 0.54
37 0.48
38 0.46
39 0.43
40 0.45
41 0.4
42 0.42
43 0.48
44 0.55
45 0.6