FuNGI

A0A0U5FWF4

Protein Details

Accession

A0A0U5FWF4

Localization Confidence

Medium

Confidence Score

10.8

NoLS Segment(s)

Position	Sequence	Protein Nature
13-43	PLNPWQFKTRRREAKSESRKRKKEYETGEDE	Hydrophilic

NLS Segment(s)

Position	Sequence
21-35	TRRREAKSESRKRKK

Subcellular Location(s)

mito 14, nucl 9, cyto_mito 9

Family & Domain DBs

InterPro	View protein in InterPro IPR007224 TIF_Rrn11
Gene Ontology	GO:0001164 F:RNA polymerase I core promoter sequence-specific DNA binding GO:0001181 F:RNA polymerase I general transcription initiation factor activity
Pfam	View protein in Pfam PF04090 RNA_pol_I_TF

Amino Acid Sequences

MAFVRSRSVSSLPLNPWQFKTRRREAKSESRKRKKEYETGEDEDDTHNGDGGWTTDAVSDLGTAAPSAILSPEEAHQYRVAGLGFGEELPGGHFPHGPAKTKSRGVESLSRHELISQSAAHQGNLRHQHLAVLMSLLDRCLANGDYIRAGRAWGLIIREHFGGRPIDIRVGGRWGIGAEILLRQGQQKSTEPPESDRGALLSILLRQGQENSTEPPESDKEASGRAEEPDELLFTRDGFENAKLYYETLIIQHPYQKTMPNATSALHFYPVMFSLWIYVTQEESAHARKTLDKRDLKSSTEASDEEDDQSDPEHHAYRSARRQSMVAGIRANELVEAQKIAARIDEIILSPPYSDSPELLELRSMVSLWIADLFVSSLPSGGNDGGTLEDQNTREDDSDGDDVFMSTETQYDSVQARRDRRLAMEKKQMEMEKSQEFLERAQLRKQGVASKLEDFHIDTDDDDDISLHSVEPY

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.47
2	0.48
3	0.5
4	0.54
5	0.56
6	0.57
7	0.63
8	0.65
9	0.71
10	0.73
11	0.79
12	0.79
13	0.83
14	0.86
15	0.87
16	0.88
17	0.88
18	0.9
19	0.88
20	0.89
21	0.87
22	0.85
23	0.83
24	0.82
25	0.79
26	0.75
27	0.71
28	0.61
29	0.54
30	0.46
31	0.37
32	0.29
33	0.21
34	0.16
35	0.12
36	0.11
37	0.1
38	0.1
39	0.11
40	0.08
41	0.09
42	0.09
43	0.1
44	0.1
45	0.09
46	0.08
47	0.07
48	0.07
49	0.06
50	0.06
51	0.05
52	0.05
53	0.05
54	0.05
55	0.05
56	0.05
57	0.06
58	0.07
59	0.09
60	0.16
61	0.16
62	0.18
63	0.18
64	0.19
65	0.18
66	0.19
67	0.18
68	0.11
69	0.11
70	0.1
71	0.09
72	0.09
73	0.08
74	0.06
75	0.06
76	0.07
77	0.08
78	0.08
79	0.09
80	0.1
81	0.11
82	0.19
83	0.23
84	0.27
85	0.3
86	0.36
87	0.42
88	0.47
89	0.48
90	0.46
91	0.46
92	0.46
93	0.5
94	0.48
95	0.5
96	0.49
97	0.47
98	0.41
99	0.38
100	0.33
101	0.27
102	0.24
103	0.16
104	0.13
105	0.19
106	0.2
107	0.19
108	0.22
109	0.21
110	0.27
111	0.34
112	0.34
113	0.29
114	0.28
115	0.29
116	0.27
117	0.27
118	0.19
119	0.12
120	0.1
121	0.09
122	0.09
123	0.08
124	0.07
125	0.06
126	0.06
127	0.07
128	0.08
129	0.08
130	0.09
131	0.1
132	0.12
133	0.13
134	0.13
135	0.11
136	0.11
137	0.1
138	0.1
139	0.09
140	0.09
141	0.1
142	0.11
143	0.12
144	0.13
145	0.14
146	0.14
147	0.13
148	0.14
149	0.13
150	0.12
151	0.14
152	0.13
153	0.14
154	0.15
155	0.15
156	0.13
157	0.15
158	0.14
159	0.12
160	0.11
161	0.09
162	0.08
163	0.07
164	0.07
165	0.05
166	0.05
167	0.06
168	0.06
169	0.06
170	0.08
171	0.09
172	0.11
173	0.14
174	0.16
175	0.2
176	0.25
177	0.29
178	0.28
179	0.3
180	0.33
181	0.32
182	0.3
183	0.25
184	0.2
185	0.16
186	0.15
187	0.12
188	0.08
189	0.07
190	0.07
191	0.08
192	0.07
193	0.07
194	0.08
195	0.09
196	0.1
197	0.11
198	0.12
199	0.14
200	0.14
201	0.14
202	0.16
203	0.16
204	0.16
205	0.16
206	0.14
207	0.13
208	0.15
209	0.16
210	0.14
211	0.14
212	0.12
213	0.12
214	0.11
215	0.11
216	0.09
217	0.09
218	0.08
219	0.08
220	0.07
221	0.06
222	0.07
223	0.07
224	0.07
225	0.08
226	0.09
227	0.09
228	0.09
229	0.1
230	0.09
231	0.09
232	0.09
233	0.08
234	0.08
235	0.08
236	0.09
237	0.09
238	0.09
239	0.14
240	0.14
241	0.16
242	0.16
243	0.18
244	0.19
245	0.22
246	0.23
247	0.2
248	0.21
249	0.19
250	0.19
251	0.18
252	0.17
253	0.13
254	0.13
255	0.1
256	0.1
257	0.1
258	0.09
259	0.07
260	0.07
261	0.07
262	0.07
263	0.08
264	0.08
265	0.07
266	0.07
267	0.08
268	0.08
269	0.07
270	0.1
271	0.12
272	0.12
273	0.13
274	0.13
275	0.19
276	0.25
277	0.32
278	0.39
279	0.42
280	0.45
281	0.53
282	0.56
283	0.52
284	0.5
285	0.45
286	0.37
287	0.33
288	0.3
289	0.24
290	0.22
291	0.21
292	0.17
293	0.16
294	0.15
295	0.12
296	0.13
297	0.11
298	0.1
299	0.11
300	0.12
301	0.11
302	0.16
303	0.19
304	0.26
305	0.35
306	0.42
307	0.42
308	0.41
309	0.42
310	0.38
311	0.44
312	0.39
313	0.33
314	0.27
315	0.25
316	0.25
317	0.25
318	0.23
319	0.14
320	0.11
321	0.09
322	0.08
323	0.08
324	0.07
325	0.08
326	0.09
327	0.09
328	0.09
329	0.08
330	0.08
331	0.08
332	0.09
333	0.08
334	0.1
335	0.1
336	0.1
337	0.1
338	0.1
339	0.1
340	0.12
341	0.12
342	0.1
343	0.12
344	0.17
345	0.17
346	0.17
347	0.17
348	0.15
349	0.15
350	0.15
351	0.12
352	0.07
353	0.07
354	0.06
355	0.06
356	0.06
357	0.05
358	0.05
359	0.05
360	0.06
361	0.05
362	0.06
363	0.06
364	0.06
365	0.06
366	0.06
367	0.08
368	0.07
369	0.07
370	0.06
371	0.07
372	0.08
373	0.08
374	0.09
375	0.08
376	0.12
377	0.13
378	0.14
379	0.15
380	0.15
381	0.16
382	0.16
383	0.15
384	0.16
385	0.18
386	0.17
387	0.16
388	0.15
389	0.14
390	0.14
391	0.13
392	0.1
393	0.07
394	0.08
395	0.08
396	0.09
397	0.09
398	0.11
399	0.14
400	0.17
401	0.25
402	0.31
403	0.36
404	0.42
405	0.46
406	0.46
407	0.51
408	0.58
409	0.59
410	0.61
411	0.66
412	0.62
413	0.61
414	0.65
415	0.62
416	0.54
417	0.51
418	0.47
419	0.4
420	0.39
421	0.37
422	0.34
423	0.32
424	0.29
425	0.34
426	0.35
427	0.34
428	0.39
429	0.43
430	0.4
431	0.43
432	0.46
433	0.43
434	0.42
435	0.45
436	0.42
437	0.42
438	0.42
439	0.39
440	0.38
441	0.32
442	0.28
443	0.25
444	0.22
445	0.17
446	0.17
447	0.16
448	0.15
449	0.13
450	0.12
451	0.1
452	0.11
453	0.11

A0A0U5FWF4

3D AlphaFold-predicted Structure Viewer