Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8RHA7

Protein Details
Accession A0A0J8RHA7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MYLPRRLRRCKPAPSGGRFPDRDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR034733  AcCoA_carboxyl  
IPR029045  ClpP/crotonase-like_dom_sf  
IPR011763  COA_CT_C  
IPR011762  COA_CT_N  
IPR045190  MCCB/AccD1-like  
Gene Ontology GO:0016874  F:ligase activity  
GO:0016740  F:transferase activity  
GO:0006552  P:leucine catabolic process  
Pfam View protein in Pfam  
PF01039  Carboxyl_trans  
PROSITE View protein in PROSITE  
PS50989  COA_CT_CTER  
PS50980  COA_CT_NTER  
Amino Acid Sequences MYLPRRLRRCKPAPSGGRFPDRDHFGRIFFNQARMSSLGIPQISVVMGPCTAGGAYVPAMSDETIIVENQGTIFLAGPPLVKAATGEVVSAEDLGGGKLHSSISGVTDYLAVDDAHALVLARRSISNLNYPKTSFPLLTSAQFKEPLYDPAELAGIVGTNLRRQIPAHEVIARIVDGSEFAEFKRDYGTTLVTGFARIYGTQVGIVANNGILFSESSLKGAHFIELCAQRNIPLVFLQNISGFMVGADAEKGGIAKNGAKLVTAVACADVPKFTVVFGSSAGAGNYGMCGRAYSPRFLYMWPNAKIGVMGSEQLSSVMAAVGKSADPSLKARIDAESEATFSSARLWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.82
4 0.82
5 0.74
6 0.69
7 0.66
8 0.64
9 0.58
10 0.54
11 0.49
12 0.42
13 0.45
14 0.42
15 0.43
16 0.38
17 0.4
18 0.37
19 0.36
20 0.36
21 0.32
22 0.33
23 0.26
24 0.26
25 0.25
26 0.22
27 0.21
28 0.17
29 0.17
30 0.14
31 0.12
32 0.1
33 0.07
34 0.07
35 0.07
36 0.07
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.06
43 0.06
44 0.06
45 0.06
46 0.07
47 0.07
48 0.08
49 0.06
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.05
59 0.05
60 0.06
61 0.05
62 0.06
63 0.06
64 0.07
65 0.07
66 0.07
67 0.07
68 0.06
69 0.06
70 0.07
71 0.09
72 0.09
73 0.08
74 0.08
75 0.08
76 0.08
77 0.08
78 0.07
79 0.05
80 0.05
81 0.05
82 0.05
83 0.04
84 0.04
85 0.05
86 0.05
87 0.05
88 0.05
89 0.06
90 0.07
91 0.08
92 0.08
93 0.07
94 0.08
95 0.08
96 0.07
97 0.08
98 0.06
99 0.06
100 0.06
101 0.05
102 0.05
103 0.05
104 0.04
105 0.04
106 0.06
107 0.06
108 0.07
109 0.07
110 0.09
111 0.12
112 0.13
113 0.22
114 0.25
115 0.28
116 0.29
117 0.3
118 0.29
119 0.3
120 0.3
121 0.21
122 0.17
123 0.19
124 0.18
125 0.2
126 0.23
127 0.21
128 0.21
129 0.23
130 0.22
131 0.2
132 0.19
133 0.2
134 0.19
135 0.18
136 0.16
137 0.14
138 0.15
139 0.12
140 0.11
141 0.07
142 0.04
143 0.04
144 0.05
145 0.05
146 0.05
147 0.07
148 0.07
149 0.08
150 0.08
151 0.11
152 0.15
153 0.17
154 0.18
155 0.18
156 0.18
157 0.18
158 0.18
159 0.15
160 0.1
161 0.08
162 0.06
163 0.04
164 0.04
165 0.05
166 0.04
167 0.04
168 0.09
169 0.09
170 0.09
171 0.11
172 0.1
173 0.11
174 0.12
175 0.13
176 0.1
177 0.1
178 0.11
179 0.09
180 0.09
181 0.08
182 0.07
183 0.07
184 0.06
185 0.07
186 0.06
187 0.06
188 0.06
189 0.07
190 0.06
191 0.06
192 0.06
193 0.05
194 0.04
195 0.04
196 0.04
197 0.03
198 0.04
199 0.04
200 0.04
201 0.08
202 0.08
203 0.08
204 0.09
205 0.09
206 0.11
207 0.11
208 0.12
209 0.09
210 0.09
211 0.15
212 0.2
213 0.22
214 0.21
215 0.21
216 0.2
217 0.24
218 0.24
219 0.19
220 0.14
221 0.14
222 0.14
223 0.15
224 0.15
225 0.11
226 0.12
227 0.11
228 0.1
229 0.08
230 0.06
231 0.06
232 0.05
233 0.05
234 0.04
235 0.04
236 0.04
237 0.04
238 0.04
239 0.04
240 0.05
241 0.06
242 0.08
243 0.11
244 0.13
245 0.13
246 0.13
247 0.13
248 0.14
249 0.14
250 0.12
251 0.1
252 0.08
253 0.08
254 0.09
255 0.09
256 0.08
257 0.08
258 0.08
259 0.08
260 0.07
261 0.08
262 0.09
263 0.09
264 0.09
265 0.09
266 0.09
267 0.1
268 0.1
269 0.09
270 0.08
271 0.07
272 0.08
273 0.07
274 0.07
275 0.06
276 0.07
277 0.08
278 0.16
279 0.19
280 0.22
281 0.24
282 0.27
283 0.28
284 0.29
285 0.34
286 0.35
287 0.41
288 0.4
289 0.39
290 0.36
291 0.35
292 0.34
293 0.27
294 0.21
295 0.14
296 0.12
297 0.12
298 0.12
299 0.12
300 0.12
301 0.11
302 0.08
303 0.07
304 0.07
305 0.07
306 0.06
307 0.07
308 0.08
309 0.08
310 0.08
311 0.09
312 0.1
313 0.12
314 0.15
315 0.21
316 0.23
317 0.24
318 0.25
319 0.26
320 0.29
321 0.28
322 0.3
323 0.24
324 0.23
325 0.22
326 0.21
327 0.19
328 0.15