Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8RN21

Protein Details
Accession A0A0J8RN21    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
82-108HGNQAQKREKNNSSHRRRTNRSASETLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 2, golg 2
Family & Domain DBs
Amino Acid Sequences MDEREKTIITLVTTKRSKTLQAQPPLRVIADTTFFGFWKSQRCNFGNSLWLEDPSRVQESMTRGLCNLRTLGGDPSNSRPNHGNQAQKREKNNSSHRRRTNRSASETL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.36
4 0.39
5 0.4
6 0.48
7 0.48
8 0.55
9 0.6
10 0.59
11 0.6
12 0.57
13 0.48
14 0.38
15 0.3
16 0.22
17 0.18
18 0.16
19 0.14
20 0.13
21 0.12
22 0.14
23 0.14
24 0.13
25 0.19
26 0.23
27 0.26
28 0.33
29 0.34
30 0.38
31 0.38
32 0.38
33 0.35
34 0.31
35 0.31
36 0.24
37 0.24
38 0.2
39 0.18
40 0.17
41 0.14
42 0.15
43 0.1
44 0.1
45 0.12
46 0.15
47 0.21
48 0.22
49 0.2
50 0.18
51 0.2
52 0.21
53 0.19
54 0.17
55 0.11
56 0.1
57 0.12
58 0.15
59 0.15
60 0.16
61 0.17
62 0.22
63 0.29
64 0.28
65 0.29
66 0.29
67 0.3
68 0.38
69 0.42
70 0.47
71 0.46
72 0.57
73 0.65
74 0.68
75 0.71
76 0.7
77 0.71
78 0.71
79 0.76
80 0.76
81 0.77
82 0.81
83 0.84
84 0.86
85 0.87
86 0.88
87 0.88
88 0.86