Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8UN56

Protein Details
Accession A0A0J8UN56    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
80-99TARRTEYGEQNKKRRSGRKNBasic
NLS Segment(s)
PositionSequence
91-98KKRRSGRK
Subcellular Location(s) plas 7, mito 6, cyto 4, pero 3, E.R. 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAGTEPTPTAAMLVMIFHDRMGIAFLLFIPGSISIHLLSPPELRKTEAENLRHGIGKLCDHRRRIAGRHYDPFLAAVEETARRTEYGEQNKKRRSGRKNVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.07
5 0.07
6 0.07
7 0.07
8 0.08
9 0.07
10 0.06
11 0.06
12 0.06
13 0.07
14 0.07
15 0.07
16 0.06
17 0.06
18 0.06
19 0.06
20 0.07
21 0.06
22 0.06
23 0.07
24 0.07
25 0.08
26 0.11
27 0.13
28 0.15
29 0.15
30 0.17
31 0.18
32 0.21
33 0.28
34 0.31
35 0.31
36 0.3
37 0.31
38 0.31
39 0.3
40 0.26
41 0.21
42 0.16
43 0.18
44 0.23
45 0.31
46 0.35
47 0.36
48 0.39
49 0.43
50 0.46
51 0.47
52 0.49
53 0.5
54 0.51
55 0.54
56 0.54
57 0.48
58 0.44
59 0.4
60 0.31
61 0.22
62 0.15
63 0.1
64 0.1
65 0.11
66 0.12
67 0.12
68 0.12
69 0.11
70 0.13
71 0.2
72 0.28
73 0.37
74 0.47
75 0.56
76 0.65
77 0.72
78 0.78
79 0.8
80 0.81
81 0.79