Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8RUG6

Protein Details
Accession A0A0J8RUG6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
117-154GITPTSKHKPVKQRPKIEQKKVKKPRRSGKTTNTHMAGHydrophilic
NLS Segment(s)
PositionSequence
123-146KHKPVKQRPKIEQKKVKKPRRSGK
Subcellular Location(s) mito 17, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR040501  TFA2_Winged_2  
IPR016656  TFIIE-bsu  
Gene Ontology GO:0005673  C:transcription factor TFIIE complex  
GO:0003743  F:translation initiation factor activity  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF18121  TFA2_Winged_2  
Amino Acid Sequences MSYFQNQISSFSNSVISAASRLPQDRRAPELQSQPTAQGMSVRELREGWPNFVETINKLEKKGKLLVTRNKKDDHPRMVWANDPTLIHQFDSEFRQIWEKVKIPDQQTVAEELEKAGITPTSKHKPVKQRPKIEQKKVKKPRRSGKTTNTHMAGILRDYSHLKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.15
4 0.11
5 0.11
6 0.12
7 0.14
8 0.18
9 0.21
10 0.27
11 0.34
12 0.37
13 0.42
14 0.44
15 0.45
16 0.48
17 0.54
18 0.5
19 0.47
20 0.44
21 0.38
22 0.36
23 0.32
24 0.26
25 0.2
26 0.17
27 0.18
28 0.21
29 0.21
30 0.2
31 0.2
32 0.22
33 0.27
34 0.27
35 0.25
36 0.22
37 0.22
38 0.22
39 0.23
40 0.22
41 0.14
42 0.18
43 0.22
44 0.22
45 0.23
46 0.27
47 0.28
48 0.31
49 0.35
50 0.35
51 0.37
52 0.44
53 0.52
54 0.58
55 0.62
56 0.63
57 0.6
58 0.59
59 0.6
60 0.6
61 0.58
62 0.5
63 0.47
64 0.46
65 0.44
66 0.43
67 0.35
68 0.27
69 0.22
70 0.19
71 0.16
72 0.16
73 0.16
74 0.12
75 0.11
76 0.11
77 0.11
78 0.14
79 0.14
80 0.12
81 0.12
82 0.15
83 0.16
84 0.18
85 0.21
86 0.21
87 0.23
88 0.28
89 0.33
90 0.32
91 0.36
92 0.35
93 0.32
94 0.3
95 0.31
96 0.25
97 0.2
98 0.18
99 0.13
100 0.12
101 0.1
102 0.09
103 0.06
104 0.07
105 0.07
106 0.1
107 0.18
108 0.24
109 0.3
110 0.35
111 0.42
112 0.52
113 0.63
114 0.71
115 0.74
116 0.77
117 0.82
118 0.89
119 0.92
120 0.92
121 0.91
122 0.9
123 0.92
124 0.92
125 0.93
126 0.91
127 0.91
128 0.91
129 0.91
130 0.9
131 0.89
132 0.88
133 0.88
134 0.86
135 0.84
136 0.76
137 0.65
138 0.57
139 0.49
140 0.4
141 0.32
142 0.27
143 0.18
144 0.18