Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8UGC7

Protein Details
Accession A0A0J8UGC7    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
37-60LAPGRRSRRPQLIFRRTRRRTEHGBasic
NLS Segment(s)
PositionSequence
42-46RSRRP
51-54RRTR
Subcellular Location(s) nucl 9, cyto 7, mito 6, extr 2, pero 2
Family & Domain DBs
Amino Acid Sequences MYRLHGLFAQREWFSSVILSIPIRFLDLRFVQLNLPLAPGRRSRRPQLIFRRTRRRTEHGDLSGRSLHGRVMITTRLRSLVTPLVGAGLKEYENAAVPLMVTAFTSPPASVKEPIHNGRVNPPNLFQAISLPHHTRSQTYFDNSRCWITRRQQTAIHHFSPQALSSDNLPQSPSTPPRCLSTAVPRQPTSDRIYSQACPPRSVDGPAVEVAALGVSFPLSPEKSVQFGINCYYCPRCASMVGYKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.17
4 0.12
5 0.14
6 0.14
7 0.12
8 0.13
9 0.12
10 0.14
11 0.14
12 0.13
13 0.18
14 0.18
15 0.22
16 0.22
17 0.23
18 0.22
19 0.24
20 0.26
21 0.19
22 0.2
23 0.17
24 0.18
25 0.21
26 0.28
27 0.32
28 0.39
29 0.45
30 0.51
31 0.6
32 0.65
33 0.71
34 0.74
35 0.79
36 0.8
37 0.84
38 0.87
39 0.82
40 0.85
41 0.83
42 0.78
43 0.76
44 0.74
45 0.74
46 0.7
47 0.71
48 0.62
49 0.58
50 0.53
51 0.44
52 0.36
53 0.27
54 0.2
55 0.16
56 0.16
57 0.13
58 0.14
59 0.18
60 0.2
61 0.21
62 0.21
63 0.2
64 0.19
65 0.19
66 0.19
67 0.18
68 0.16
69 0.15
70 0.14
71 0.14
72 0.14
73 0.13
74 0.1
75 0.07
76 0.07
77 0.07
78 0.07
79 0.06
80 0.06
81 0.07
82 0.06
83 0.05
84 0.05
85 0.05
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.05
92 0.05
93 0.05
94 0.06
95 0.09
96 0.11
97 0.14
98 0.15
99 0.19
100 0.24
101 0.27
102 0.3
103 0.29
104 0.28
105 0.32
106 0.38
107 0.35
108 0.3
109 0.29
110 0.26
111 0.25
112 0.24
113 0.17
114 0.12
115 0.13
116 0.14
117 0.16
118 0.16
119 0.17
120 0.18
121 0.19
122 0.19
123 0.19
124 0.22
125 0.22
126 0.25
127 0.29
128 0.28
129 0.32
130 0.31
131 0.32
132 0.28
133 0.28
134 0.31
135 0.33
136 0.4
137 0.42
138 0.44
139 0.47
140 0.51
141 0.58
142 0.57
143 0.51
144 0.44
145 0.39
146 0.37
147 0.32
148 0.27
149 0.18
150 0.13
151 0.12
152 0.12
153 0.18
154 0.17
155 0.17
156 0.17
157 0.15
158 0.16
159 0.22
160 0.27
161 0.27
162 0.29
163 0.3
164 0.33
165 0.34
166 0.35
167 0.34
168 0.37
169 0.42
170 0.45
171 0.5
172 0.48
173 0.49
174 0.49
175 0.5
176 0.45
177 0.41
178 0.35
179 0.33
180 0.36
181 0.35
182 0.41
183 0.44
184 0.4
185 0.36
186 0.36
187 0.37
188 0.35
189 0.37
190 0.32
191 0.26
192 0.26
193 0.24
194 0.23
195 0.18
196 0.16
197 0.12
198 0.09
199 0.06
200 0.04
201 0.03
202 0.03
203 0.03
204 0.04
205 0.09
206 0.1
207 0.11
208 0.15
209 0.17
210 0.2
211 0.21
212 0.24
213 0.22
214 0.23
215 0.28
216 0.26
217 0.25
218 0.27
219 0.29
220 0.27
221 0.27
222 0.28
223 0.24
224 0.25
225 0.3