Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8UDN8

Protein Details
Accession A0A0J8UDN8   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
73-97HSPGPSGRRRKGKRVKRNEAPPESEBasic
NLS Segment(s)
PositionSequence
77-93PSGRRRKGKRVKRNEAP
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MGYCQRRGWSDGRVMILIETQGNPNRFVPAAQTAFSHPCIDDQNEDTSPLRRHGRYLNPDSFHTAREFYHIAHSPGPSGRRRKGKRVKRNEAPPESEESEWPPGEKGWRLRARQPMRRPDVGENLSRSPGVDHPPPQIPPLHGAARREPM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.27
4 0.22
5 0.16
6 0.13
7 0.14
8 0.19
9 0.21
10 0.22
11 0.22
12 0.23
13 0.22
14 0.21
15 0.21
16 0.22
17 0.23
18 0.21
19 0.22
20 0.23
21 0.25
22 0.26
23 0.24
24 0.17
25 0.17
26 0.19
27 0.2
28 0.19
29 0.19
30 0.22
31 0.21
32 0.23
33 0.22
34 0.23
35 0.23
36 0.26
37 0.29
38 0.25
39 0.28
40 0.32
41 0.41
42 0.45
43 0.51
44 0.52
45 0.49
46 0.49
47 0.52
48 0.46
49 0.38
50 0.3
51 0.24
52 0.18
53 0.19
54 0.19
55 0.13
56 0.18
57 0.18
58 0.18
59 0.19
60 0.19
61 0.16
62 0.18
63 0.21
64 0.21
65 0.26
66 0.31
67 0.4
68 0.45
69 0.54
70 0.63
71 0.7
72 0.75
73 0.8
74 0.84
75 0.83
76 0.89
77 0.88
78 0.83
79 0.77
80 0.68
81 0.63
82 0.55
83 0.47
84 0.37
85 0.3
86 0.28
87 0.23
88 0.22
89 0.16
90 0.14
91 0.17
92 0.21
93 0.23
94 0.29
95 0.37
96 0.4
97 0.46
98 0.56
99 0.63
100 0.68
101 0.72
102 0.73
103 0.72
104 0.74
105 0.71
106 0.66
107 0.66
108 0.6
109 0.56
110 0.5
111 0.45
112 0.42
113 0.37
114 0.32
115 0.25
116 0.25
117 0.25
118 0.27
119 0.27
120 0.31
121 0.36
122 0.37
123 0.37
124 0.37
125 0.33
126 0.31
127 0.34
128 0.36
129 0.35
130 0.38