Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8RDX7

Protein Details
Accession A0A0J8RDX7   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-27GAEARKKEKGRFRRVARQALNWHydrophilic
NLS Segment(s)
PositionSequence
9-20ARKKEKGRFRRV
Subcellular Location(s) mito 10.5, nucl 10, cyto_mito 8.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MKRIIGAEARKKEKGRFRRVARQALNWKIAVTIHGQPRSRGSEGGEGEMLERGCGKSEKKEKEKRNDASLVQAVRRANDGTIRAVGEFEAMGERKLWRRTVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.71
3 0.72
4 0.75
5 0.79
6 0.84
7 0.86
8 0.8
9 0.79
10 0.78
11 0.74
12 0.69
13 0.58
14 0.5
15 0.4
16 0.35
17 0.27
18 0.21
19 0.2
20 0.23
21 0.28
22 0.28
23 0.29
24 0.33
25 0.36
26 0.34
27 0.29
28 0.25
29 0.25
30 0.25
31 0.26
32 0.22
33 0.17
34 0.16
35 0.17
36 0.14
37 0.07
38 0.07
39 0.06
40 0.07
41 0.09
42 0.1
43 0.17
44 0.26
45 0.35
46 0.45
47 0.54
48 0.62
49 0.71
50 0.8
51 0.76
52 0.74
53 0.7
54 0.6
55 0.57
56 0.52
57 0.44
58 0.35
59 0.34
60 0.27
61 0.24
62 0.25
63 0.19
64 0.16
65 0.18
66 0.19
67 0.18
68 0.19
69 0.19
70 0.17
71 0.17
72 0.15
73 0.12
74 0.1
75 0.08
76 0.1
77 0.1
78 0.11
79 0.12
80 0.16
81 0.22
82 0.27