Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8S6C4

Protein Details
Accession A0A0J8S6C4   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
292-319ASIPKQRRREFARELRRRRQEMKEQAQSHydrophilic
NLS Segment(s)
PositionSequence
280-310GPGRRPRSYSAGASIPKQRRREFARELRRRR
Subcellular Location(s) nucl 19, cyto 4, mito 2
Family & Domain DBs
Amino Acid Sequences MSPAAWELREMSPPWEDDDYDVGIVDRPVPEYTPDLYIRHYMRDMCTMVSLKWLILVRCESLLRPETIRALAGQDEERSAEVDDAFWRVWTFCRLFGCGKGREEDIVAQADWLSGGSRARSHNRNSSALLTCPLAVDSVLFDPPSGFAGGNQGGLTATQLYDMMEIWTCLGVLVQVFYGKNDEAQSWTQYLLTLGPSAILTLSSLNPDTPIETMFARAQSLGWTKWTSPTKANSGSNRSFLKEAVSRVYDNRLVRGKEVPRFQTPNLQQSQSPQIARPSGPGRRPRSYSAGASIPKQRRREFARELRRRRQEMKEQAQSTTPAIHIAPRGPSPEAEEKISQGRHPSPAPYQRRSRTPVPTFIDPADKALHKLACHWTSKPLLNYCSLKAGLAVTPLEDAAEGAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.26
4 0.24
5 0.26
6 0.24
7 0.2
8 0.2
9 0.15
10 0.14
11 0.14
12 0.14
13 0.12
14 0.12
15 0.13
16 0.14
17 0.16
18 0.18
19 0.2
20 0.23
21 0.25
22 0.24
23 0.25
24 0.31
25 0.31
26 0.32
27 0.33
28 0.31
29 0.31
30 0.36
31 0.34
32 0.28
33 0.31
34 0.29
35 0.26
36 0.27
37 0.25
38 0.19
39 0.22
40 0.24
41 0.2
42 0.22
43 0.24
44 0.2
45 0.22
46 0.24
47 0.2
48 0.23
49 0.26
50 0.24
51 0.24
52 0.25
53 0.25
54 0.25
55 0.25
56 0.19
57 0.18
58 0.17
59 0.17
60 0.17
61 0.15
62 0.15
63 0.15
64 0.15
65 0.14
66 0.13
67 0.11
68 0.1
69 0.1
70 0.1
71 0.11
72 0.11
73 0.1
74 0.1
75 0.1
76 0.12
77 0.17
78 0.17
79 0.19
80 0.21
81 0.24
82 0.25
83 0.32
84 0.37
85 0.36
86 0.37
87 0.35
88 0.34
89 0.31
90 0.31
91 0.26
92 0.21
93 0.18
94 0.16
95 0.14
96 0.13
97 0.12
98 0.1
99 0.08
100 0.06
101 0.06
102 0.07
103 0.08
104 0.11
105 0.16
106 0.23
107 0.29
108 0.34
109 0.41
110 0.45
111 0.47
112 0.46
113 0.47
114 0.42
115 0.37
116 0.33
117 0.25
118 0.2
119 0.17
120 0.15
121 0.1
122 0.08
123 0.07
124 0.06
125 0.07
126 0.07
127 0.07
128 0.07
129 0.07
130 0.07
131 0.08
132 0.08
133 0.06
134 0.06
135 0.1
136 0.11
137 0.11
138 0.1
139 0.09
140 0.08
141 0.09
142 0.09
143 0.05
144 0.04
145 0.04
146 0.04
147 0.04
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.04
157 0.04
158 0.03
159 0.03
160 0.04
161 0.03
162 0.05
163 0.05
164 0.06
165 0.07
166 0.07
167 0.09
168 0.09
169 0.09
170 0.11
171 0.12
172 0.13
173 0.12
174 0.13
175 0.11
176 0.11
177 0.11
178 0.08
179 0.07
180 0.06
181 0.05
182 0.05
183 0.05
184 0.05
185 0.05
186 0.04
187 0.04
188 0.04
189 0.05
190 0.05
191 0.06
192 0.05
193 0.06
194 0.06
195 0.07
196 0.06
197 0.07
198 0.07
199 0.07
200 0.09
201 0.09
202 0.09
203 0.09
204 0.08
205 0.08
206 0.1
207 0.12
208 0.11
209 0.12
210 0.13
211 0.13
212 0.21
213 0.24
214 0.23
215 0.25
216 0.29
217 0.32
218 0.37
219 0.42
220 0.4
221 0.44
222 0.44
223 0.44
224 0.42
225 0.38
226 0.33
227 0.28
228 0.27
229 0.22
230 0.22
231 0.21
232 0.21
233 0.21
234 0.21
235 0.25
236 0.26
237 0.23
238 0.27
239 0.29
240 0.27
241 0.28
242 0.34
243 0.35
244 0.36
245 0.42
246 0.41
247 0.42
248 0.46
249 0.45
250 0.48
251 0.46
252 0.48
253 0.46
254 0.43
255 0.37
256 0.36
257 0.43
258 0.37
259 0.35
260 0.28
261 0.28
262 0.3
263 0.3
264 0.31
265 0.3
266 0.33
267 0.39
268 0.46
269 0.5
270 0.53
271 0.57
272 0.57
273 0.58
274 0.55
275 0.5
276 0.45
277 0.44
278 0.4
279 0.39
280 0.44
281 0.45
282 0.48
283 0.53
284 0.52
285 0.54
286 0.61
287 0.66
288 0.67
289 0.69
290 0.73
291 0.76
292 0.83
293 0.85
294 0.87
295 0.85
296 0.82
297 0.81
298 0.8
299 0.8
300 0.81
301 0.8
302 0.72
303 0.67
304 0.62
305 0.54
306 0.45
307 0.36
308 0.26
309 0.18
310 0.16
311 0.17
312 0.17
313 0.17
314 0.19
315 0.19
316 0.22
317 0.22
318 0.22
319 0.26
320 0.32
321 0.32
322 0.33
323 0.31
324 0.31
325 0.36
326 0.37
327 0.33
328 0.31
329 0.33
330 0.34
331 0.35
332 0.37
333 0.4
334 0.49
335 0.56
336 0.57
337 0.63
338 0.65
339 0.72
340 0.74
341 0.73
342 0.73
343 0.71
344 0.72
345 0.69
346 0.67
347 0.62
348 0.57
349 0.56
350 0.46
351 0.42
352 0.38
353 0.32
354 0.29
355 0.32
356 0.32
357 0.26
358 0.31
359 0.38
360 0.38
361 0.41
362 0.41
363 0.42
364 0.46
365 0.52
366 0.53
367 0.51
368 0.48
369 0.51
370 0.54
371 0.49
372 0.48
373 0.42
374 0.35
375 0.29
376 0.28
377 0.22
378 0.21
379 0.19
380 0.14
381 0.14
382 0.14
383 0.13
384 0.11