Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8RSQ3

Protein Details
Accession A0A0J8RSQ3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
106-127GSQSRSRQPGAKKRKTRGSCEGHydrophilic
NLS Segment(s)
PositionSequence
115-120GAKKRK
Subcellular Location(s) nucl 13, mito 13, mito_nucl 13
Family & Domain DBs
Amino Acid Sequences MIGDPSVGAGGVQGRKNKREPYWTRYHGTGSRRTTDSGSLVLFLACGRDSGVSAAGVWGLGLKETRQKVGLPSGRLALRNRNNFTGSIHGFEIEATYPSVKLIEFGSQSRSRQPGAKKRKTRGSCEGQGERTGWNAIHRWTDLASRPRKRGATASEQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.45
4 0.51
5 0.53
6 0.59
7 0.62
8 0.64
9 0.69
10 0.69
11 0.66
12 0.61
13 0.61
14 0.56
15 0.54
16 0.55
17 0.49
18 0.49
19 0.47
20 0.46
21 0.42
22 0.39
23 0.34
24 0.27
25 0.22
26 0.17
27 0.16
28 0.14
29 0.12
30 0.09
31 0.08
32 0.06
33 0.06
34 0.05
35 0.05
36 0.06
37 0.07
38 0.08
39 0.06
40 0.06
41 0.06
42 0.06
43 0.05
44 0.04
45 0.04
46 0.03
47 0.04
48 0.04
49 0.05
50 0.1
51 0.12
52 0.13
53 0.13
54 0.14
55 0.16
56 0.24
57 0.28
58 0.24
59 0.24
60 0.26
61 0.26
62 0.28
63 0.28
64 0.28
65 0.31
66 0.37
67 0.38
68 0.37
69 0.37
70 0.35
71 0.34
72 0.31
73 0.25
74 0.2
75 0.18
76 0.15
77 0.14
78 0.13
79 0.13
80 0.08
81 0.07
82 0.06
83 0.06
84 0.06
85 0.06
86 0.07
87 0.06
88 0.06
89 0.06
90 0.09
91 0.1
92 0.11
93 0.18
94 0.2
95 0.22
96 0.26
97 0.27
98 0.26
99 0.31
100 0.39
101 0.44
102 0.52
103 0.62
104 0.66
105 0.72
106 0.81
107 0.82
108 0.81
109 0.8
110 0.78
111 0.75
112 0.74
113 0.72
114 0.64
115 0.6
116 0.53
117 0.44
118 0.36
119 0.3
120 0.22
121 0.19
122 0.19
123 0.2
124 0.22
125 0.22
126 0.22
127 0.22
128 0.27
129 0.31
130 0.38
131 0.45
132 0.49
133 0.54
134 0.6
135 0.62
136 0.6
137 0.61
138 0.59