Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8RFJ0

Protein Details
Accession A0A0J8RFJ0    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
38-58PDVASRRRTGRYKKRAPPAIQHydrophilic
92-117GAEFRRHQLLRRRLQRPRRTVEQECEHydrophilic
NLS Segment(s)
PositionSequence
19-54RRKKAELKDGEKALMIGAKPDVASRRRTGRYKKRAP
Subcellular Location(s) nucl 20, cyto 4, mito 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MLKREEEEEREREEEEEERRKKAELKDGEKALMIGAKPDVASRRRTGRYKKRAPPAIQPMTNRELRPCIGISSGRVASKPPFLEKLGWYDRGAEFRRHQLLRRRLQRPRRTVEQECETETSKGSLDFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.39
4 0.37
5 0.38
6 0.38
7 0.4
8 0.44
9 0.45
10 0.47
11 0.47
12 0.51
13 0.56
14 0.57
15 0.55
16 0.49
17 0.42
18 0.33
19 0.25
20 0.18
21 0.11
22 0.09
23 0.09
24 0.09
25 0.11
26 0.15
27 0.16
28 0.2
29 0.23
30 0.31
31 0.37
32 0.45
33 0.54
34 0.59
35 0.68
36 0.74
37 0.78
38 0.8
39 0.83
40 0.79
41 0.77
42 0.76
43 0.73
44 0.66
45 0.59
46 0.53
47 0.48
48 0.48
49 0.39
50 0.3
51 0.25
52 0.21
53 0.21
54 0.18
55 0.14
56 0.13
57 0.13
58 0.13
59 0.15
60 0.16
61 0.14
62 0.14
63 0.15
64 0.15
65 0.19
66 0.19
67 0.18
68 0.19
69 0.2
70 0.23
71 0.22
72 0.28
73 0.28
74 0.29
75 0.27
76 0.27
77 0.27
78 0.31
79 0.33
80 0.31
81 0.3
82 0.34
83 0.42
84 0.41
85 0.47
86 0.5
87 0.57
88 0.62
89 0.69
90 0.72
91 0.74
92 0.83
93 0.86
94 0.85
95 0.84
96 0.83
97 0.82
98 0.8
99 0.79
100 0.77
101 0.7
102 0.64
103 0.59
104 0.52
105 0.44
106 0.38
107 0.3
108 0.23