Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8RQD7

Protein Details
Accession A0A0J8RQD7    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-36DMEFSKPKMRLKKRPTCRQHGPQARYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 7.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSYSIFLFELDMEFSKPKMRLKKRPTCRQHGPQARYILASACSVQGNFCFSKFSQDFGRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.19
4 0.24
5 0.33
6 0.42
7 0.51
8 0.61
9 0.71
10 0.77
11 0.85
12 0.86
13 0.85
14 0.85
15 0.82
16 0.82
17 0.81
18 0.74
19 0.69
20 0.65
21 0.56
22 0.47
23 0.39
24 0.3
25 0.21
26 0.18
27 0.13
28 0.11
29 0.11
30 0.1
31 0.1
32 0.1
33 0.13
34 0.13
35 0.13
36 0.15
37 0.15
38 0.25
39 0.25
40 0.28