Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8RHW0

Protein Details
Accession A0A0J8RHW0    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
49-69DQEKKERLRKPTKRISRKTLLBasic
NLS Segment(s)
PositionSequence
52-66KKERLRKPTKRISRK
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
Amino Acid Sequences MATPGPVTSDRQFILLAWAWILLHFLKHKRRQAQIYVPDNASLTIPDLDQEKKERLRKPTKRISRKTLLRSQHSAALLKFLTLLEPSRKRRLKSIFSTDIRAELVDLVVIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.18
4 0.14
5 0.14
6 0.12
7 0.12
8 0.13
9 0.08
10 0.09
11 0.13
12 0.21
13 0.3
14 0.38
15 0.46
16 0.52
17 0.6
18 0.63
19 0.67
20 0.69
21 0.7
22 0.67
23 0.63
24 0.56
25 0.49
26 0.43
27 0.35
28 0.25
29 0.15
30 0.11
31 0.08
32 0.07
33 0.07
34 0.09
35 0.09
36 0.11
37 0.13
38 0.16
39 0.22
40 0.29
41 0.34
42 0.41
43 0.52
44 0.59
45 0.65
46 0.72
47 0.76
48 0.8
49 0.82
50 0.81
51 0.8
52 0.8
53 0.78
54 0.76
55 0.73
56 0.68
57 0.65
58 0.59
59 0.54
60 0.48
61 0.42
62 0.34
63 0.3
64 0.24
65 0.19
66 0.18
67 0.12
68 0.11
69 0.1
70 0.13
71 0.18
72 0.27
73 0.32
74 0.43
75 0.48
76 0.5
77 0.58
78 0.64
79 0.65
80 0.66
81 0.7
82 0.7
83 0.67
84 0.71
85 0.62
86 0.55
87 0.46
88 0.37
89 0.27
90 0.18
91 0.15