Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8RCB3

Protein Details
Accession A0A0J8RCB3    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
83-109NPPSCLRTSRPHLKRKISRIQILPRVRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
Amino Acid Sequences MAMTGLYSTSLYSGDGQHEEVPVLPRRAIDGATPHAGFRPRSPRPEKPDRGDLSGWLSGSVSCVRGRRSPEISITLPSYPPANPPSCLRTSRPHLKRKISRIQILPRVRPGAFTGKPGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.16
5 0.16
6 0.15
7 0.16
8 0.19
9 0.21
10 0.21
11 0.2
12 0.19
13 0.21
14 0.22
15 0.21
16 0.18
17 0.17
18 0.19
19 0.22
20 0.22
21 0.2
22 0.21
23 0.24
24 0.23
25 0.24
26 0.3
27 0.32
28 0.41
29 0.48
30 0.54
31 0.6
32 0.7
33 0.71
34 0.67
35 0.72
36 0.65
37 0.62
38 0.54
39 0.46
40 0.39
41 0.33
42 0.27
43 0.17
44 0.15
45 0.1
46 0.11
47 0.11
48 0.08
49 0.09
50 0.11
51 0.13
52 0.17
53 0.21
54 0.25
55 0.28
56 0.29
57 0.3
58 0.33
59 0.32
60 0.3
61 0.28
62 0.24
63 0.2
64 0.18
65 0.17
66 0.12
67 0.15
68 0.18
69 0.18
70 0.19
71 0.22
72 0.27
73 0.3
74 0.33
75 0.33
76 0.37
77 0.44
78 0.53
79 0.59
80 0.63
81 0.68
82 0.75
83 0.8
84 0.82
85 0.84
86 0.82
87 0.81
88 0.8
89 0.81
90 0.8
91 0.79
92 0.75
93 0.71
94 0.67
95 0.59
96 0.52
97 0.47
98 0.47
99 0.4