Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3JC07

Protein Details
Accession G3JC07    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPDKIKKGSGKKGDKSNPSSHydrophilic
NLS Segment(s)
PositionSequence
6-12KKGSGKK
Subcellular Location(s) nucl 13, mito 7, cyto 6
Family & Domain DBs
KEGG cmt:CCM_01994  -  
Amino Acid Sequences MPDKIKKGSGKKGDKSNPSSEPSPAVRKWYREHAPSWRNQSPGAACQGDEWPPYYFLQKSDDEFKLGGEDPRGGRIRFIPAKHNGGAGNVCCLLGEGEADR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.76
4 0.7
5 0.66
6 0.6
7 0.51
8 0.47
9 0.42
10 0.43
11 0.37
12 0.4
13 0.38
14 0.41
15 0.43
16 0.48
17 0.49
18 0.46
19 0.49
20 0.51
21 0.53
22 0.55
23 0.6
24 0.54
25 0.49
26 0.46
27 0.44
28 0.36
29 0.32
30 0.3
31 0.21
32 0.18
33 0.17
34 0.18
35 0.16
36 0.15
37 0.14
38 0.11
39 0.12
40 0.12
41 0.13
42 0.13
43 0.12
44 0.16
45 0.16
46 0.17
47 0.22
48 0.22
49 0.22
50 0.21
51 0.2
52 0.18
53 0.18
54 0.17
55 0.12
56 0.15
57 0.14
58 0.2
59 0.23
60 0.21
61 0.21
62 0.22
63 0.3
64 0.33
65 0.34
66 0.35
67 0.39
68 0.44
69 0.43
70 0.44
71 0.35
72 0.33
73 0.34
74 0.28
75 0.25
76 0.2
77 0.19
78 0.16
79 0.16
80 0.14
81 0.1