Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8S152

Protein Details
Accession A0A0J8S152   
Localization Confidence High
Confidence Score 22.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-85SRSISPSRSRSPPPRDRSRSVSSGRSRSASPRRSPSPRARSRSRSRSRTPRSRTRSLTPRSRSPSPRRNGRGRGRSLSHydrophilic
181-205QIAHMHERPTRRRRPQCLHRSYPPHBasic
224-250GIPAPSRYRSPPRRRFRAPRGMDRHDLBasic
273-307PLYSSRSPTPPPRRRGRRDSYDSPRRRRRGSSYDSHydrophilic
NLS Segment(s)
PositionSequence
13-90PSRSRSPPPRDRSRSVSSGRSRSASPRRSPSPRARSRSRSRSRTPRSRTRSLTPRSRSPSPRRNGRGRGRSLSRTDSR
99-106SRDRHGGR
230-303RYRSPPRRRFRAPRGMDRHDLYRPRSVSRSRSRTRSPPPPARSPLYSSRSPTPPPRRRGRRDSYDSPRRRRRGS
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
Amino Acid Sequences MPTRRSISRSISPSRSRSPPPRDRSRSVSSGRSRSASPRRSPSPRARSRSRSRSRTPRSRTRSLTPRSRSPSPRRNGRGRGRSLSRTDSRSPYSSRTPSRDRHGGRYRDRSYSRSPSPPRRSTKIVVEKLTKNVNEDHLREIFGAYGDIQSIDLPMNRQFMTNRRDRRIYAITMPLMPSQQIAHMHERPTRRRRPQCLHRSYPPHILRSHFQHGYPRAPNSTTGIPAPSRYRSPPRRRFRAPRGMDRHDLYRPRSVSRSRSRTRSPPPPARSPLYSSRSPTPPPRRRGRRDSYDSPRRRRRGSSYDSLSNRSRSPSRSRYSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.69
3 0.69
4 0.72
5 0.74
6 0.75
7 0.77
8 0.82
9 0.83
10 0.82
11 0.81
12 0.78
13 0.76
14 0.71
15 0.71
16 0.69
17 0.68
18 0.65
19 0.6
20 0.54
21 0.56
22 0.61
23 0.6
24 0.6
25 0.61
26 0.66
27 0.72
28 0.78
29 0.79
30 0.8
31 0.81
32 0.81
33 0.82
34 0.83
35 0.86
36 0.88
37 0.88
38 0.86
39 0.86
40 0.89
41 0.9
42 0.9
43 0.89
44 0.88
45 0.86
46 0.86
47 0.83
48 0.81
49 0.8
50 0.78
51 0.8
52 0.75
53 0.77
54 0.74
55 0.77
56 0.77
57 0.77
58 0.78
59 0.77
60 0.81
61 0.8
62 0.82
63 0.84
64 0.84
65 0.83
66 0.81
67 0.8
68 0.76
69 0.74
70 0.69
71 0.67
72 0.62
73 0.58
74 0.55
75 0.52
76 0.5
77 0.48
78 0.46
79 0.43
80 0.45
81 0.47
82 0.49
83 0.51
84 0.53
85 0.55
86 0.59
87 0.64
88 0.59
89 0.62
90 0.65
91 0.67
92 0.68
93 0.73
94 0.69
95 0.68
96 0.68
97 0.62
98 0.6
99 0.6
100 0.57
101 0.56
102 0.61
103 0.63
104 0.7
105 0.74
106 0.73
107 0.7
108 0.71
109 0.65
110 0.67
111 0.66
112 0.62
113 0.58
114 0.57
115 0.54
116 0.52
117 0.54
118 0.43
119 0.35
120 0.31
121 0.32
122 0.31
123 0.3
124 0.29
125 0.24
126 0.25
127 0.23
128 0.21
129 0.15
130 0.1
131 0.09
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.04
138 0.05
139 0.05
140 0.05
141 0.06
142 0.08
143 0.1
144 0.1
145 0.11
146 0.12
147 0.18
148 0.23
149 0.3
150 0.35
151 0.36
152 0.39
153 0.39
154 0.44
155 0.41
156 0.39
157 0.34
158 0.31
159 0.28
160 0.26
161 0.27
162 0.21
163 0.17
164 0.14
165 0.11
166 0.08
167 0.09
168 0.11
169 0.13
170 0.18
171 0.21
172 0.24
173 0.28
174 0.34
175 0.41
176 0.48
177 0.55
178 0.6
179 0.67
180 0.74
181 0.8
182 0.85
183 0.86
184 0.86
185 0.83
186 0.81
187 0.79
188 0.74
189 0.74
190 0.67
191 0.6
192 0.53
193 0.49
194 0.45
195 0.44
196 0.47
197 0.38
198 0.35
199 0.39
200 0.4
201 0.44
202 0.44
203 0.4
204 0.35
205 0.34
206 0.35
207 0.31
208 0.29
209 0.23
210 0.2
211 0.2
212 0.18
213 0.2
214 0.23
215 0.22
216 0.24
217 0.28
218 0.38
219 0.46
220 0.57
221 0.64
222 0.71
223 0.77
224 0.84
225 0.88
226 0.88
227 0.89
228 0.85
229 0.86
230 0.84
231 0.81
232 0.77
233 0.69
234 0.64
235 0.6
236 0.58
237 0.51
238 0.5
239 0.46
240 0.44
241 0.49
242 0.5
243 0.53
244 0.57
245 0.64
246 0.63
247 0.69
248 0.72
249 0.75
250 0.78
251 0.79
252 0.79
253 0.79
254 0.79
255 0.8
256 0.79
257 0.74
258 0.69
259 0.65
260 0.64
261 0.59
262 0.57
263 0.52
264 0.53
265 0.53
266 0.54
267 0.59
268 0.61
269 0.64
270 0.69
271 0.75
272 0.79
273 0.84
274 0.89
275 0.88
276 0.88
277 0.87
278 0.88
279 0.88
280 0.88
281 0.89
282 0.89
283 0.89
284 0.87
285 0.84
286 0.82
287 0.81
288 0.8
289 0.79
290 0.78
291 0.76
292 0.77
293 0.75
294 0.72
295 0.68
296 0.61
297 0.55
298 0.52
299 0.49
300 0.46
301 0.52
302 0.56
303 0.61