Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8S620

Protein Details
Accession A0A0J8S620    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
12-32KSLSSRPQKRATRVNERNPSAHydrophilic
NLS Segment(s)
PositionSequence
53-61AKRKSRGKL
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MASKPGLQNDAKSLSSRPQKRATRVNERNPSAEPPTSMATDLLKALNKPVEGAKRKSRGKLQAQHKVHIKKAEEDLNGLISQNKLTCSEVRKAQLDRLSDLVEQKAELEAKIISQLQSLNYLYKAATR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.41
3 0.46
4 0.47
5 0.53
6 0.6
7 0.66
8 0.73
9 0.73
10 0.75
11 0.77
12 0.81
13 0.81
14 0.76
15 0.71
16 0.64
17 0.6
18 0.53
19 0.44
20 0.35
21 0.28
22 0.27
23 0.24
24 0.22
25 0.18
26 0.14
27 0.14
28 0.13
29 0.12
30 0.11
31 0.11
32 0.12
33 0.13
34 0.13
35 0.13
36 0.16
37 0.23
38 0.27
39 0.33
40 0.39
41 0.46
42 0.49
43 0.53
44 0.56
45 0.56
46 0.6
47 0.64
48 0.65
49 0.66
50 0.66
51 0.66
52 0.66
53 0.61
54 0.54
55 0.51
56 0.43
57 0.36
58 0.38
59 0.38
60 0.31
61 0.29
62 0.26
63 0.22
64 0.21
65 0.17
66 0.14
67 0.09
68 0.09
69 0.09
70 0.09
71 0.09
72 0.11
73 0.15
74 0.18
75 0.22
76 0.26
77 0.3
78 0.34
79 0.34
80 0.38
81 0.39
82 0.37
83 0.35
84 0.32
85 0.3
86 0.27
87 0.27
88 0.23
89 0.19
90 0.16
91 0.15
92 0.15
93 0.14
94 0.12
95 0.11
96 0.1
97 0.1
98 0.13
99 0.14
100 0.12
101 0.12
102 0.14
103 0.14
104 0.18
105 0.19
106 0.18
107 0.17
108 0.18