Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3J307

Protein Details
Accession G3J307    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
229-251LPTPVLCKSAQQKRKKRVPRDQQHydrophilic
NLS Segment(s)
PositionSequence
242-245RKKR
Subcellular Location(s) nucl 7plas 7, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
Gene Ontology GO:0016020  C:membrane  
KEGG cmt:CCM_00244  -  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
Amino Acid Sequences MADTELRQRKAKDNDGKANESAKVRTRTSEDDNLGSIRLDILRVLTFLFVASCGLSYVISSGESFFWGMHNKPYYLKPEWWKAKFGGPIYLTPDELSQYNGYEEGKPLYLAVNGTIFDVSNGLHMYGVGGSYHFFAGRDASRAYVSGCFEEDLTPDMRGLEEMYLPIDDPETDSKWTTAEMKELKEQELAEASERVYNGLKHWVDFFTNSPKYQMVGYVKREEGWLEKLPTPVLCKSAQQKRKKRVPRDQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.75
3 0.76
4 0.7
5 0.64
6 0.58
7 0.51
8 0.46
9 0.44
10 0.43
11 0.4
12 0.41
13 0.43
14 0.45
15 0.49
16 0.53
17 0.47
18 0.43
19 0.43
20 0.4
21 0.35
22 0.29
23 0.21
24 0.14
25 0.11
26 0.1
27 0.08
28 0.09
29 0.09
30 0.09
31 0.09
32 0.08
33 0.08
34 0.07
35 0.07
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.06
42 0.05
43 0.05
44 0.05
45 0.06
46 0.06
47 0.06
48 0.07
49 0.07
50 0.07
51 0.08
52 0.07
53 0.09
54 0.11
55 0.12
56 0.17
57 0.19
58 0.2
59 0.22
60 0.26
61 0.3
62 0.32
63 0.37
64 0.37
65 0.45
66 0.53
67 0.53
68 0.52
69 0.47
70 0.49
71 0.47
72 0.42
73 0.38
74 0.31
75 0.3
76 0.32
77 0.32
78 0.26
79 0.22
80 0.21
81 0.15
82 0.14
83 0.14
84 0.09
85 0.09
86 0.09
87 0.09
88 0.1
89 0.1
90 0.1
91 0.09
92 0.09
93 0.08
94 0.08
95 0.08
96 0.08
97 0.07
98 0.07
99 0.07
100 0.06
101 0.07
102 0.07
103 0.06
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.03
116 0.03
117 0.04
118 0.04
119 0.05
120 0.04
121 0.05
122 0.05
123 0.07
124 0.08
125 0.1
126 0.09
127 0.1
128 0.1
129 0.1
130 0.11
131 0.11
132 0.12
133 0.1
134 0.1
135 0.1
136 0.1
137 0.1
138 0.1
139 0.09
140 0.09
141 0.09
142 0.08
143 0.08
144 0.08
145 0.08
146 0.08
147 0.06
148 0.06
149 0.05
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.05
156 0.07
157 0.1
158 0.11
159 0.12
160 0.13
161 0.13
162 0.13
163 0.15
164 0.16
165 0.14
166 0.19
167 0.21
168 0.23
169 0.28
170 0.29
171 0.29
172 0.28
173 0.28
174 0.22
175 0.21
176 0.2
177 0.16
178 0.15
179 0.14
180 0.14
181 0.14
182 0.14
183 0.13
184 0.13
185 0.13
186 0.21
187 0.21
188 0.2
189 0.22
190 0.22
191 0.22
192 0.23
193 0.25
194 0.26
195 0.29
196 0.29
197 0.3
198 0.28
199 0.28
200 0.26
201 0.3
202 0.28
203 0.32
204 0.37
205 0.41
206 0.41
207 0.41
208 0.41
209 0.36
210 0.32
211 0.3
212 0.31
213 0.29
214 0.32
215 0.33
216 0.34
217 0.34
218 0.35
219 0.31
220 0.28
221 0.26
222 0.29
223 0.37
224 0.46
225 0.53
226 0.6
227 0.68
228 0.75
229 0.84
230 0.89
231 0.9