Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8RWD3

Protein Details
Accession A0A0J8RWD3   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MRRNSRKGQQYQAKRLKSRKFKLRQHAEKTNGYRHydrophilic
NLS Segment(s)
PositionSequence
14-22KRLKSRKFK
Subcellular Location(s) nucl 13.5, mito_nucl 10, cyto 6, mito 5.5
Family & Domain DBs
Amino Acid Sequences MRRNSRKGQQYQAKRLKSRKFKLRQHAEKTNGYRNSQPTEDASFNRDNIGQAYGGETDGILSAPAHPNPMRRVGDIRDIILWSSAIERKFWCPRFVLQMRIGALDLDHKGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.84
4 0.85
5 0.84
6 0.84
7 0.85
8 0.86
9 0.88
10 0.9
11 0.9
12 0.88
13 0.88
14 0.83
15 0.81
16 0.77
17 0.75
18 0.69
19 0.61
20 0.57
21 0.51
22 0.5
23 0.42
24 0.37
25 0.31
26 0.3
27 0.3
28 0.26
29 0.27
30 0.23
31 0.23
32 0.22
33 0.2
34 0.15
35 0.14
36 0.14
37 0.09
38 0.08
39 0.09
40 0.08
41 0.07
42 0.07
43 0.05
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.05
50 0.07
51 0.07
52 0.1
53 0.11
54 0.14
55 0.17
56 0.24
57 0.25
58 0.25
59 0.28
60 0.28
61 0.35
62 0.33
63 0.31
64 0.25
65 0.24
66 0.22
67 0.19
68 0.16
69 0.09
70 0.11
71 0.13
72 0.12
73 0.14
74 0.15
75 0.22
76 0.32
77 0.34
78 0.34
79 0.34
80 0.37
81 0.46
82 0.48
83 0.48
84 0.42
85 0.45
86 0.43
87 0.41
88 0.38
89 0.27
90 0.24
91 0.21