Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8RIJ6

Protein Details
Accession A0A0J8RIJ6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
64-126AHPNREPGKKRNRASKRTRERRRGQGRSDVADVEKRSLNKEKTRREKKRMKRPRKQKKNKPQDBasic
NLS Segment(s)
PositionSequence
68-124REPGKKRNRASKRTRERRRGQGRSDVADVEKRSLNKEKTRREKKRMKRPRKQKKNKP
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAQLRAAQLARKQGETVTAATPADSLPQKRPAEDEEESENDDGDTGNEYEASSNTGEGDHEVTAHPNREPGKKRNRASKRTRERRRGQGRSDVADVEKRSLNKEKTRREKKRMKRPRKQKKNKPQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.28
4 0.2
5 0.19
6 0.18
7 0.17
8 0.17
9 0.12
10 0.15
11 0.16
12 0.17
13 0.2
14 0.3
15 0.3
16 0.31
17 0.33
18 0.32
19 0.35
20 0.34
21 0.32
22 0.28
23 0.28
24 0.29
25 0.27
26 0.24
27 0.17
28 0.15
29 0.12
30 0.07
31 0.08
32 0.06
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.08
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.07
46 0.05
47 0.06
48 0.06
49 0.08
50 0.09
51 0.1
52 0.09
53 0.12
54 0.15
55 0.22
56 0.28
57 0.35
58 0.45
59 0.53
60 0.58
61 0.66
62 0.73
63 0.76
64 0.8
65 0.83
66 0.83
67 0.85
68 0.9
69 0.9
70 0.89
71 0.9
72 0.9
73 0.88
74 0.82
75 0.81
76 0.75
77 0.68
78 0.61
79 0.52
80 0.43
81 0.39
82 0.35
83 0.28
84 0.26
85 0.23
86 0.27
87 0.34
88 0.39
89 0.44
90 0.53
91 0.61
92 0.69
93 0.8
94 0.85
95 0.87
96 0.91
97 0.92
98 0.93
99 0.94
100 0.94
101 0.94
102 0.95
103 0.95
104 0.96
105 0.97
106 0.97