Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8UFC4

Protein Details
Accession A0A0J8UFC4   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
261-280LSVQKRVRQQTQRRARQERIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027786  Nse4/EID  
IPR014854  Nse4_C  
IPR029225  Nse4_Nse3-bd  
Gene Ontology GO:0005634  C:nucleus  
GO:0030915  C:Smc5-Smc6 complex  
GO:0006310  P:DNA recombination  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF15412  Nse4-Nse3_bdg  
PF08743  Nse4_C  
Amino Acid Sequences MADTAADSGSDLSSTPPGSNAVSPSNSFSSDKENGASPGASRIEKRKQESWQAQSSNARSDMGDASNKRRRISGKDPGGDGHAAHRRALALVNDTNYYDPEQDPEERRAVRKGLRDLATKLNDSRSEFIQAGSNGIRETIIKANELFKQVKQTSDATIDSRLLVNAADLSYKRTAQAILGDSDSGIDVEEFVSKCISFMRAMPVGEGSPSQTLSSQRQPHDRNAEDSDDDDDALNWDVLGRQACFPHNKRPPLSGFLYGPLSVQKRVRQQTQRRARQERIDPSQAIRPQQLQAEDLGRQETANLTAICTEIRKILVSTQQRGEKLATDVLSNMREPSRDQILEVMYKYNISDDGGVPLFKFCINPRSFGQTVENLFYVSFLVRDGSVGVALDASDLPTLHPSTPALPSEAQRKGLQKHQAVFSLDFETWRNLIEVFDIKKPLIPHRNEDAESSQVNRDMLVGQHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.14
5 0.16
6 0.19
7 0.2
8 0.23
9 0.24
10 0.25
11 0.29
12 0.29
13 0.3
14 0.29
15 0.27
16 0.3
17 0.31
18 0.31
19 0.28
20 0.28
21 0.26
22 0.27
23 0.26
24 0.19
25 0.22
26 0.24
27 0.24
28 0.26
29 0.33
30 0.41
31 0.48
32 0.54
33 0.55
34 0.59
35 0.68
36 0.74
37 0.73
38 0.72
39 0.67
40 0.66
41 0.67
42 0.62
43 0.56
44 0.48
45 0.41
46 0.31
47 0.32
48 0.29
49 0.25
50 0.3
51 0.27
52 0.36
53 0.43
54 0.46
55 0.44
56 0.47
57 0.48
58 0.5
59 0.56
60 0.57
61 0.59
62 0.6
63 0.61
64 0.56
65 0.54
66 0.46
67 0.37
68 0.34
69 0.31
70 0.28
71 0.26
72 0.26
73 0.23
74 0.23
75 0.26
76 0.2
77 0.18
78 0.2
79 0.21
80 0.21
81 0.22
82 0.21
83 0.19
84 0.19
85 0.16
86 0.13
87 0.14
88 0.16
89 0.21
90 0.24
91 0.27
92 0.31
93 0.32
94 0.34
95 0.37
96 0.39
97 0.39
98 0.43
99 0.46
100 0.48
101 0.5
102 0.51
103 0.51
104 0.54
105 0.52
106 0.46
107 0.42
108 0.39
109 0.37
110 0.36
111 0.35
112 0.28
113 0.28
114 0.26
115 0.25
116 0.24
117 0.21
118 0.21
119 0.19
120 0.18
121 0.14
122 0.14
123 0.14
124 0.09
125 0.12
126 0.14
127 0.14
128 0.15
129 0.16
130 0.19
131 0.22
132 0.26
133 0.25
134 0.21
135 0.3
136 0.3
137 0.3
138 0.3
139 0.29
140 0.26
141 0.28
142 0.28
143 0.2
144 0.21
145 0.19
146 0.17
147 0.16
148 0.13
149 0.1
150 0.08
151 0.07
152 0.06
153 0.06
154 0.07
155 0.07
156 0.1
157 0.12
158 0.12
159 0.12
160 0.12
161 0.12
162 0.12
163 0.16
164 0.14
165 0.14
166 0.14
167 0.13
168 0.12
169 0.12
170 0.11
171 0.07
172 0.05
173 0.03
174 0.03
175 0.04
176 0.07
177 0.07
178 0.07
179 0.08
180 0.07
181 0.08
182 0.08
183 0.09
184 0.07
185 0.08
186 0.13
187 0.14
188 0.15
189 0.15
190 0.15
191 0.13
192 0.13
193 0.12
194 0.09
195 0.07
196 0.07
197 0.07
198 0.08
199 0.11
200 0.15
201 0.22
202 0.27
203 0.29
204 0.37
205 0.4
206 0.44
207 0.5
208 0.47
209 0.44
210 0.41
211 0.4
212 0.32
213 0.29
214 0.25
215 0.17
216 0.16
217 0.12
218 0.09
219 0.07
220 0.08
221 0.07
222 0.04
223 0.04
224 0.04
225 0.06
226 0.07
227 0.07
228 0.07
229 0.09
230 0.12
231 0.19
232 0.22
233 0.31
234 0.37
235 0.42
236 0.43
237 0.46
238 0.46
239 0.45
240 0.44
241 0.37
242 0.3
243 0.26
244 0.26
245 0.21
246 0.19
247 0.17
248 0.16
249 0.16
250 0.19
251 0.22
252 0.29
253 0.34
254 0.42
255 0.49
256 0.57
257 0.65
258 0.73
259 0.78
260 0.79
261 0.82
262 0.78
263 0.76
264 0.75
265 0.72
266 0.68
267 0.64
268 0.55
269 0.5
270 0.51
271 0.46
272 0.4
273 0.33
274 0.29
275 0.25
276 0.27
277 0.26
278 0.19
279 0.18
280 0.18
281 0.17
282 0.16
283 0.15
284 0.12
285 0.11
286 0.1
287 0.09
288 0.09
289 0.11
290 0.1
291 0.1
292 0.1
293 0.1
294 0.11
295 0.1
296 0.1
297 0.08
298 0.08
299 0.09
300 0.09
301 0.12
302 0.2
303 0.24
304 0.28
305 0.32
306 0.36
307 0.36
308 0.37
309 0.35
310 0.3
311 0.27
312 0.25
313 0.2
314 0.16
315 0.16
316 0.17
317 0.18
318 0.16
319 0.16
320 0.13
321 0.14
322 0.15
323 0.18
324 0.23
325 0.21
326 0.21
327 0.23
328 0.24
329 0.26
330 0.25
331 0.23
332 0.16
333 0.16
334 0.16
335 0.13
336 0.11
337 0.09
338 0.11
339 0.09
340 0.13
341 0.13
342 0.13
343 0.13
344 0.12
345 0.12
346 0.11
347 0.12
348 0.11
349 0.2
350 0.21
351 0.25
352 0.27
353 0.34
354 0.34
355 0.35
356 0.37
357 0.33
358 0.34
359 0.33
360 0.31
361 0.23
362 0.22
363 0.2
364 0.16
365 0.11
366 0.08
367 0.06
368 0.07
369 0.06
370 0.07
371 0.07
372 0.07
373 0.07
374 0.07
375 0.06
376 0.05
377 0.05
378 0.06
379 0.05
380 0.06
381 0.06
382 0.06
383 0.07
384 0.1
385 0.12
386 0.11
387 0.13
388 0.13
389 0.16
390 0.2
391 0.2
392 0.21
393 0.21
394 0.24
395 0.32
396 0.35
397 0.36
398 0.36
399 0.42
400 0.43
401 0.49
402 0.55
403 0.53
404 0.55
405 0.55
406 0.57
407 0.54
408 0.51
409 0.46
410 0.4
411 0.34
412 0.29
413 0.27
414 0.24
415 0.2
416 0.2
417 0.18
418 0.14
419 0.14
420 0.16
421 0.21
422 0.21
423 0.25
424 0.26
425 0.26
426 0.29
427 0.32
428 0.38
429 0.42
430 0.44
431 0.46
432 0.53
433 0.6
434 0.58
435 0.59
436 0.52
437 0.47
438 0.44
439 0.41
440 0.35
441 0.31
442 0.3
443 0.25
444 0.22
445 0.19