Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8RPE1

Protein Details
Accession A0A0J8RPE1    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
131-153IEAYKRQREQKGKRDEQRRRDASBasic
NLS Segment(s)
PositionSequence
92-123EAKVAEKRKRKASDAEGQRKSARQKTTLGGRK
135-161KRQREQKGKRDEQRRRDASSRKKDGRS
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004343  Plus-3_dom  
IPR036128  Plus3-like_sf  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF03126  Plus-3  
PROSITE View protein in PROSITE  
PS51360  PLUS3  
Amino Acid Sequences MSRSSSTPRSRKSLNSASMSESESEGSPPDEDNQGPIFSYEKLFYSAKDKEEIMAMPEIQREELLSERAQLVDRHNQDIALRRLLAMREREEAKVAEKRKRKASDAEGQRKSARQKTTLGGRKVGETSDAIEAYKRQREQKGKRDEQRRRDASSRKKDGRSRSLEGSDVDAHGESEVEWDEGAARRSTSPTKDDPPAEFRDFERARVSRSNFAQYCFYPNFEKLITGCYTRINVGPHPDTGELVYRLCLITGRPCGGFSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.63
3 0.59
4 0.57
5 0.54
6 0.49
7 0.4
8 0.31
9 0.24
10 0.19
11 0.17
12 0.14
13 0.13
14 0.12
15 0.12
16 0.14
17 0.15
18 0.15
19 0.18
20 0.18
21 0.17
22 0.17
23 0.16
24 0.16
25 0.14
26 0.16
27 0.14
28 0.13
29 0.17
30 0.17
31 0.17
32 0.23
33 0.26
34 0.26
35 0.28
36 0.27
37 0.23
38 0.25
39 0.24
40 0.2
41 0.18
42 0.16
43 0.15
44 0.16
45 0.16
46 0.14
47 0.13
48 0.11
49 0.1
50 0.12
51 0.13
52 0.11
53 0.12
54 0.12
55 0.13
56 0.15
57 0.15
58 0.17
59 0.23
60 0.26
61 0.27
62 0.27
63 0.26
64 0.27
65 0.33
66 0.32
67 0.26
68 0.24
69 0.21
70 0.23
71 0.24
72 0.27
73 0.23
74 0.22
75 0.23
76 0.25
77 0.26
78 0.26
79 0.25
80 0.24
81 0.27
82 0.3
83 0.34
84 0.39
85 0.44
86 0.52
87 0.55
88 0.55
89 0.55
90 0.57
91 0.59
92 0.62
93 0.67
94 0.61
95 0.59
96 0.57
97 0.53
98 0.51
99 0.49
100 0.41
101 0.34
102 0.34
103 0.36
104 0.44
105 0.48
106 0.45
107 0.42
108 0.39
109 0.37
110 0.34
111 0.3
112 0.21
113 0.14
114 0.13
115 0.11
116 0.1
117 0.09
118 0.09
119 0.1
120 0.12
121 0.16
122 0.17
123 0.21
124 0.28
125 0.39
126 0.48
127 0.56
128 0.64
129 0.69
130 0.75
131 0.81
132 0.82
133 0.82
134 0.83
135 0.78
136 0.73
137 0.71
138 0.72
139 0.72
140 0.74
141 0.74
142 0.7
143 0.73
144 0.74
145 0.75
146 0.75
147 0.72
148 0.66
149 0.61
150 0.55
151 0.5
152 0.44
153 0.38
154 0.29
155 0.22
156 0.18
157 0.13
158 0.11
159 0.09
160 0.09
161 0.05
162 0.05
163 0.06
164 0.05
165 0.05
166 0.05
167 0.06
168 0.08
169 0.1
170 0.1
171 0.1
172 0.11
173 0.14
174 0.19
175 0.21
176 0.24
177 0.28
178 0.32
179 0.37
180 0.39
181 0.4
182 0.41
183 0.45
184 0.42
185 0.38
186 0.34
187 0.39
188 0.37
189 0.35
190 0.38
191 0.32
192 0.34
193 0.41
194 0.44
195 0.41
196 0.44
197 0.52
198 0.45
199 0.46
200 0.46
201 0.39
202 0.42
203 0.36
204 0.36
205 0.3
206 0.29
207 0.3
208 0.26
209 0.26
210 0.2
211 0.23
212 0.22
213 0.21
214 0.21
215 0.2
216 0.22
217 0.22
218 0.25
219 0.24
220 0.25
221 0.31
222 0.32
223 0.3
224 0.33
225 0.31
226 0.29
227 0.27
228 0.29
229 0.22
230 0.2
231 0.2
232 0.17
233 0.17
234 0.16
235 0.15
236 0.12
237 0.18
238 0.23
239 0.26
240 0.25