Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0J8S0Z1

Protein Details
Accession A0A0J8S0Z1   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-35QYEENKKIFKKDKIKQKKIKKLDEPPTIKAHydrophilic
NLS Segment(s)
PositionSequence
11-38KKIFKKDKIKQKKIKKLDEPPTIKALKK
Subcellular Location(s) nucl 21, mito 3, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MNLINQYEENKKIFKKDKIKQKKIKKLDEPPTIKALKKTASFAKTEKSELKFKVKSSNSANIEAAIKKMTNKFTNLALAMRVQSNQIQENSDQYYMLQREESLKPIPNYLTNMTVNSTTVQENT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.63
4 0.72
5 0.78
6 0.87
7 0.87
8 0.9
9 0.91
10 0.9
11 0.92
12 0.91
13 0.9
14 0.89
15 0.89
16 0.83
17 0.76
18 0.73
19 0.65
20 0.57
21 0.49
22 0.43
23 0.38
24 0.34
25 0.35
26 0.36
27 0.35
28 0.36
29 0.35
30 0.36
31 0.33
32 0.35
33 0.36
34 0.33
35 0.36
36 0.37
37 0.44
38 0.41
39 0.4
40 0.46
41 0.42
42 0.44
43 0.42
44 0.48
45 0.42
46 0.41
47 0.4
48 0.31
49 0.31
50 0.25
51 0.21
52 0.13
53 0.1
54 0.1
55 0.14
56 0.18
57 0.19
58 0.21
59 0.22
60 0.22
61 0.24
62 0.23
63 0.2
64 0.16
65 0.14
66 0.13
67 0.12
68 0.11
69 0.1
70 0.12
71 0.13
72 0.16
73 0.16
74 0.17
75 0.17
76 0.2
77 0.21
78 0.19
79 0.17
80 0.14
81 0.2
82 0.19
83 0.19
84 0.17
85 0.14
86 0.19
87 0.21
88 0.24
89 0.22
90 0.27
91 0.27
92 0.3
93 0.32
94 0.3
95 0.33
96 0.32
97 0.33
98 0.29
99 0.29
100 0.28
101 0.26
102 0.24
103 0.2
104 0.2