Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8U5M9

Protein Details
Accession A0A0J8U5M9    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-32KPPIKVPSSREKPMRPRDAPRGPSBasic
118-144QGAVKGYDKRRLKNKRGCGNNDKSRDVHydrophilic
NLS Segment(s)
PositionSequence
17-25SREKPMRPR
126-130KRRLK
Subcellular Location(s) mito 18, nucl 5, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MTARDHAAKPPIKVPSSREKPMRPRDAPRGPSEARGECLLVTRSGPSVVGEGSTIIRILCHEIPPPQEEGSGTNPGYIGISNVIFGLVACQPSRVPNTYSDLKLFREYAKREKVENRQGAVKGYDKRRLKNKRGCGNNDKSRDVDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.53
4 0.58
5 0.6
6 0.62
7 0.69
8 0.76
9 0.81
10 0.76
11 0.76
12 0.79
13 0.81
14 0.77
15 0.71
16 0.68
17 0.59
18 0.58
19 0.55
20 0.47
21 0.39
22 0.35
23 0.31
24 0.23
25 0.24
26 0.2
27 0.15
28 0.13
29 0.12
30 0.11
31 0.11
32 0.11
33 0.09
34 0.08
35 0.08
36 0.07
37 0.06
38 0.06
39 0.07
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.09
46 0.09
47 0.1
48 0.11
49 0.13
50 0.15
51 0.17
52 0.19
53 0.15
54 0.14
55 0.13
56 0.15
57 0.16
58 0.17
59 0.15
60 0.14
61 0.13
62 0.13
63 0.13
64 0.1
65 0.07
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.04
72 0.04
73 0.05
74 0.05
75 0.07
76 0.06
77 0.07
78 0.08
79 0.1
80 0.14
81 0.14
82 0.15
83 0.17
84 0.22
85 0.26
86 0.27
87 0.28
88 0.27
89 0.27
90 0.28
91 0.27
92 0.26
93 0.3
94 0.33
95 0.39
96 0.46
97 0.46
98 0.48
99 0.55
100 0.61
101 0.64
102 0.65
103 0.59
104 0.56
105 0.55
106 0.53
107 0.48
108 0.45
109 0.42
110 0.43
111 0.49
112 0.49
113 0.56
114 0.64
115 0.71
116 0.75
117 0.78
118 0.81
119 0.82
120 0.86
121 0.88
122 0.88
123 0.88
124 0.87
125 0.83
126 0.76