Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0J8RIU5

Protein Details
Accession A0A0J8RIU5    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
53-80REGNESYKSSRKRRVRARADTREKIFTPHydrophilic
NLS Segment(s)
PositionSequence
63-70RKRRVRAR
Subcellular Location(s) cyto_nucl 12.5, cyto 10.5, nucl 9.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013528  HMG_CoA_synth_N  
IPR016039  Thiolase-like  
Gene Ontology GO:0016746  F:acyltransferase activity  
Pfam View protein in Pfam  
PF01154  HMG_CoA_synt_N  
Amino Acid Sequences MSSRPQNIGIKALEVYFPSQCVDQAELEKFDGVSQGKYTIGLGQTKMSFCDDREGNESYKSSRKRRVRARADTREKIFTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.13
4 0.13
5 0.12
6 0.12
7 0.12
8 0.13
9 0.14
10 0.13
11 0.16
12 0.17
13 0.17
14 0.17
15 0.16
16 0.14
17 0.12
18 0.14
19 0.11
20 0.1
21 0.09
22 0.1
23 0.09
24 0.1
25 0.1
26 0.08
27 0.09
28 0.1
29 0.1
30 0.11
31 0.12
32 0.12
33 0.13
34 0.14
35 0.13
36 0.12
37 0.18
38 0.17
39 0.18
40 0.22
41 0.24
42 0.22
43 0.24
44 0.25
45 0.22
46 0.3
47 0.35
48 0.4
49 0.48
50 0.56
51 0.63
52 0.73
53 0.81
54 0.83
55 0.86
56 0.9
57 0.91
58 0.91
59 0.9
60 0.84